Conserved Protein Domain Family
SRA1

?
pfam07304: SRA1 
Steroid receptor RNA activator (SRA1)
This family consists of several hypothetical mammalian steroid receptor RNA activator proteins. SRA-RNAs likely to encode stable proteins are widely expressed in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA and is classified as belonging to the growing family of functional non-coding RNAs.
Statistics
?
PSSM-Id: 399942
View PSSM: pfam07304
Aligned: 10 rows
Threshold Bit Score: 227.771
Threshold Setting Gi: 1040216378
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004076694  76 APPPRSIAPPPlssvgfPPAGVATPLPQHEPmnpqRDTGVSQSEPNLELVMSVLNRALQACRVSVTDYVCNEVEKRLRLL 155 Japanese medaka
3_pfamImport   2 APPPPSDLTPP------PPPLGPGPLRSQRD----KDSSHSEAEPDVEGLMLVLNQALDACRPTVKDQVCSDVAKRLRLL 71 
XP_005461833  77 GPPPGAVATPP------PPHL--GQMRTKRE----AAISQSESEPEVEGVMSVLNGALAACRRAVKAQVCNDVAKRLHLM 144 Nile tilapia
4_pfamImport   1 GPPPASAAPPPldp-acPPPT--GLVASRHPagtaKGQPEADTEPDMDSVMSVLNLALNACRQAVKEQVCSDV-KRLRLL 76 
XP_002816012  76 GPPPPSSKAPR------SPPVGSGPASGVEP----TSFPV-ESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALL 144 Sumatran orangutan
XP_017197055  96 GPPPPS-KAPG------PPPVESCPSSCVVP----TSSPVIEPEALLEDVLRPLEQALKDCHGHTRKQLCDDISRRLVLL 164 rabbit
NP_001107371  68 VCPPSTVGAPPlgigvlPPRSDAIRKTCKET--------EPECDVCIKDVLSPLQQTLEICRDSVTKQVFNEISRRLTML 139 tropical clawed...
XP_003220029  78 ASSPCPVGLPP------PPSGLPVSCPQVDA----TNLLVSE-DCVVEDVLSPLNEALDNCRKTLRKQICDDIGKRLAIL 146 green anole
XP_003124061 122 GHLPPSSKASR------PPLGGSCPPSSMEP----TQCSVVELEILLEDVLSPLERALEDCRGHTKKQVCDDINRRLALL 191 pig
XP_029704701  57 plgpppssiappplhsvcppstasrrpvgtI----QSQPEADGEPDGDSVLSVLNCALTACRQVVKEQVCNDVAKRLRLL 132 torafugu
XP_004076694 156 EDSWRSGKLSFPVKRRMEVLARELQTGNWSSADEVHRSLMVDHVTEVSQWMVGVKRLIAEVQNLSPELLETLKNP 230 Japanese medaka
3_pfamImport  72 EASWRSGTLSLPVRRRMDTLSLELQSGRWDSADDIHRSLMVDHVTEVSQWMVGVKRLIAETRNLNPERLEPLQKP 146
XP_005461833 145 EDSWRSGRLSLPVRRRMDTLSAELQKGRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAETRNLSPELLEPLQKV 219 Nile tilapia
4_pfamImport  77 EDSWKGGKLSLPVRRRMDTLSQELRAGHWDAADKVHLSLMVDHVTEVSQWMVGVKRLIAETRKLNPELLEPLKKS 151
XP_002816012 145 QEQWAGGKLSIPVKKRMALLVQELSSHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKS 219 Sumatran orangutan
XP_017197055 165 REQWAGGKLSVPVKKRMALLVQELSSRQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLSSEEAAKEEKS 239 rabbit
NP_001107371 140 EDMWNSGKLSASVRKRMSVLARELQGQNWDSADEIHRSLMVDHVNEVSQWMVGVKRLIAEARNLPEAALLRTNQG 214 tropical clawed frog
XP_003220029 147 QQMWEQGKLSAPVRKGMRILIQEFKSQHWDAADEIHRSLMVDHVTEVNQWMVGVKRLIAETRNLPTDNLATIEHe 221 green anole
XP_003124061 192 QEQWAGGKLSVPVKKRMALLVQELSSHQWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLSSEEEANEGKS 266 pig
XP_029704701 133 EDSWKGGKLSLPVRSRMDTLSQELQSGHWDAADKIHLSLMVDHVTEVSQWMVGIKRLIAETRKLSPELLEPLKKa 207 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap