Conserved Protein Domain Family
DUF1451

?
pfam07295: DUF1451 
Zinc-ribbon containing domain
This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein.
Statistics
?
PSSM-Id: 399935
View PSSM: pfam07295
Aligned: 49 rows
Threshold Bit Score: 126.209
Threshold Setting Gi: 409028300
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rahaq2_3237         19 LKQGERDISALVQDARVRLQEEGKLTEIQIEQLTSAVRRDLHEFARSYEENQQavaeEdDGTDSVFMRVIKESLWKELAD 98  Rahne...
ESQ09974                44 AQESVPKLRQLLETVRDNMVELGELTREEAQKIAEYVERDIEDAANYIVDTGE----DlRSWWRFDLELIEQRMLEAFTS 119 uncul...
jgi:Thimo_1676          32 QQESAPRFRDLLGKVRDHMVELGELSREEANKVSDYIERDIKDAAQYIAETGD----DlRDWWRFDLELMEQRMLDMFAR 107 Thiof...
WP_005221914            32 QNETAPRLREVLDKTRDNLVELGELSREEAQRVADYIRRDIEDAAGFVAETGQ----DiRDWWRFDLELMERRLFEAFSQ 107 Maric...
WP_012970137            32 QQESAPLFREIVDKTRERMVELGELTREEAEKVSDYVKRDIEDAAKYIADTGQ----DiRDWWRFDLELMEKRMFDMFKL 107 Alloc...
WP_014703223            29 EHQTMPSLQQRIQLAKERAIELKELSGEEAEQIALWLERDMHDAVGYLQDSGE----DfATWLQFDLQQVESRFLALFAS 104 Methy...
PRJNA210423:M911_11585  36 EERAAPSLEQAIQHARKRAVDLGEITREEAHEVADYIRRDLHDMGDYLTESSR----DyQTWFRMDLQLIEARLLDLLGS 111 Ectot...
WP_015259296            31 SDRSSVALNDLLENARKEVVDAEHLNADEADRVTEYVRRDLHDLGAFLESGTQ----DwRDWLRIDLALIEASLLNALNT 106 Thioa...
jgi:TK90_2134           33 EDKTSKAITETLENARDRVQKASDLTREEAHEVMDYLRRDLQDLGAYLDSRSE----DwRGWLRIDLGLIEASVLNALER 108 Thioa...
WP_011814932            33 EDGG-PRLAQALEEIKRAMVADGELTRADADRVGGALQRDLEEAGAWLADRSHd--qPlRDWLRMDLQMLESWLWDAFSS 109 Halor...
jgi:Rahaq2_3237         99 MTDKTQLEWKEVFKDVSHHGIYHSGEVVGLGNLVCENCHFHLAVYTPEILSKCPKCGNTEFTRRP 163 Rahnella aquatilis C...
ESQ09974               120 VADMTSLELEQWAEQARRASLYQAGQITGPGTLICDRCGAETHFTRTGRIPSCADCGGLVFQRAP 184 uncultured Thiohaloc...
jgi:Thimo_1676         108 VADQTSLNLAQWAESARLMSLYQAGEITGPGTLVCDRCGAETHLVKTGRIPACADCGGTLFRRRA 172 Thioflavicoccus mobi...
WP_005221914           108 VADQTRLQLAQIAETARRMSLYQAGEITGPGTLVCDKCGAETHFVKAGRIPPCAECGATSFRRNP 172 Marichromatium
WP_012970137           108 VADQTSLQLAQWAETARQMSLYQAGEITGPGTLVCDQCGAETHFVKAGRIPPCADCGSTRFRRRT 172 Allochromatium vinosum
WP_014703223           105 VADKTRLELNQLAQQAIRAETYHTGEVTSIGTLYCVSCGGKMQFRQTARIPPCPRCHQTRFTRQP 169 Methylophaga frappieri
PRJNA210423:M911_11585 112 IADRTRVELAELEAQARVVGVWHTGEVAGPGVLRCDKCGKELHFTESGRIPPCPKCRATEFHRVr 176 Ectothiorhodospira h...
WP_015259296           107 VADRTKVELAHLAARAYRVGEWHTGEVTGPGELTCLSCGGTMHLSRVGKIPPCPHCRHTRFHRgg 171 Thioalkalivibrio nit...
jgi:TK90_2134          109 IADRTRIEITELTARAQVMGEWHTGEITGPGELLCKKCGHALHMTKVARIPPCSNCHNTTFRRGp 173 Thioalkalivibrio sp....
WP_011814932           110 VADRTSMELRGFVTTG-EPSLYHTDEIAGPGELACIACGRTVTLQRPGHIPPCPGCNHTEFVRTA 173 Halorhodospira halop...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap