Conserved Protein Domain Family
Nucleo_P87

?
pfam07267: Nucleo_P87 
Nucleopolyhedrovirus capsid protein P87
This family consists of several Nucleopolyhedrovirus capsid protein P87 sequences. P87 is expressed late in infection and concentrated in infected cell nuclei.
Statistics
?
PSSM-Id: 369296
View PSSM: pfam07267
Aligned: 5 rows
Threshold Bit Score: 764.489
Threshold Setting Gi: 81962115
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABL76033   1 MNDS-NSLLITRLAAQILSRNIQTVDVIADDKTLSLEEKIDTLTSMMLAASSPPqspaplstdMTASLIKNNSKMIANDF 79  Maruca vitrata nucl...
Q2NNY4     1 MDEQdNSLRIVTLAGHILTRDRAAINVIMRNPEQALGQKFDAIKTFVDSLKPGA---------LLENERQINSVVIANDS 71  Hyphantria cunea nu...
O41446     1 MDEQ-NSLRIAKLAGDIMTRGHADIKTIIHSPERALGQKLDAITALVDSMQPGEppetdvefqSREADVDLRSILTRQDR 79  Choristoneura fumif...
ABQ12280   1 MDER-NSLLIASLTGQILTRDPPAVQAVLHTPERSLDQKLDALADLIGAVSAAQ-----------TAEVRANSALVAQNN 68  Antheraea pernyi nu...
Q91GG2     1 MDDNnNSILIAKLAGYILTQDVTAVDQIMHTPEKSLNQKLDTLLEMIQETPLRGdvn------dnNDLISFNSDLLVQNY 74  Epiphyas postvittan...
ABL76033  80 EMRYNVLRMAVVFVKRYPRYynETTADLVADIENDLLQYQNYVNQGNYQNIEgYESLLNKAEESFIEIDsllKKDIKKIM 159 Maruca vitrata nucl...
Q2NNY4    72 IMRHRVLQIAVAFLRRALMV--GAPQVTLNTIQNLLNDYETHVKKDILDETV-IEGFLNNASALYNELR---DNNILPFI 145 Hyphantria cunea nu...
O41446    80 VLRHRVLQIAVTFLLNSPQV--KLSKKVLQSMQIALDEYTAFVTEGGSDNVK-ADDFLNRAETLYKEIR----PKIFKFI 152 Choristoneura fumif...
ABQ12280  69 ILRQRAAQTAVTFLRRARQV--GVPASALDQIQSALQQYETYVNNDGLDGTV-IDGYLSRAEAAYADVR---GANVVPFL 142 Antheraea pernyi nu...
Q91GG2    75 KVRYNTYTTALAFLQNTPQL--NIDQQLLDKMQSLVQHYKTYITTTTVDKFV-VDDLLNQIETTYGEIR---NSKLNRFM 148 Epiphyas postvittan...
ABL76033 160 DDTEAFEREQ-EAERMRAEQIAANALserrvesaddvvnr-------------------------adaniftafsnplPG 213 Maruca vitrata nucl...
Q2NNY4   146 KNAEKQAPSRtEKEKPSLEQMVQTPL----------------------------------------------------PP 173 Hyphantria cunea nu...
O41446   153 K----------RAENFSIENVVSLP-----------------------------------------------------PT 169 Choristoneura fumif...
ABQ12280 143 K--------RaESQTQAAAPTVAPPAqlyaliakfrd------------------------------praiervgnadIQ 184 Antheraea pernyi nu...
Q91GG2   149 KKLKTPARTDaVASTSFNSPSTVEPIastsfqspnytnatnnatnftntftepmkqlytlinkykinpelinniknaeIK 228 Epiphyas postvittan...
ABL76033 214 SSATRYMYESSESDtymetarrtaehytdqdkdyna---------------aytsneynslvktvllrliekALATLKKR 278 Maruca vitrata nucl...
Q2NNY4   174 TGEKELQQEIIASP----------------------------------------------------------PVIRNEQD 195 Hyphantria cunea nu...
O41446   170 TGGSNAAQQINAPQe--------------------------------------------------------lPVITNEQD 193 Choristoneura fumif...
ABQ12280 185 SALTHMTQNVEGAPlipvriyrasldtikdedarllfdlylqqdgisyeedaqaaldrilgpygaafsneseAVIAAERD 264 Antheraea pernyi nu...
Q91GG2   229 TIVTDMVNDAELSFdtiqmhrktfntlenedtdlkllfdlyknqnaitfitndeeeyqtdvesedesiiaegPFIANEQD 308 Epiphyas postvittan...
ABL76033 279 LHITTIDQLKkfrDHLNSDTDAgEFQIFfNHDDcviLKNLSNLASKFFNVRC-----------------VADTLEimlea 341 Maruca vitrata nucl...
Q2NNY4   196 FDKLNIRQLS---DYINRNNRK-LLNYTaAHES---VDDVRNFAKAVWRANNapdyteqtpmpeqswqsPQQTPAyteqt 268 Hyphantria cunea nu...
O41446   194 FDRLNIEQLT---DYIKNNFVG-QFDFD-KHGS---VEDVRDFAKTVWWQTTtytap-------asmpsPPQTPA----- 253 Choristoneura fumif...
ABQ12280 265 FDRMDIEQLT---EYIKHNYSG-QFDFN-MHNS---VNDVREFAKTVWRANKtpmpe-------qswqtPAPTPM----- 324 Antheraea pernyi nu...
Q91GG2   309 IDNLTIDKLV---DYIRKNNNNlQTNIS-TQQS---IGDMRIFAKSLWRQKN---------------------------- 353 Epiphyas postvittan...
ABL76033 342 irNNIELVQPESDPVRRIVIKMTQEikDSTTPLYNIA---------------------MYKsdyEAIKNEniKTLFDLYN 400 Maruca vitrata nucl...
Q2NNY4   269 pmPEQSWQSPQQTPAYTEQTPMPEQ--SWQSPQQTPAyteqtpmpeqgwqspqqtpnlQPM---QTPNPV--YEWEEKLR 341 Hyphantria cunea nu...
O41446   254 -----SMPSPPQTPASMTSPPQTPA--SMTSPPQTPAwatpy-----------tsptrMTSptqQGRQSPpdYTWEERLR 315 Choristoneura fumif...
ABQ12280 325 --PERSWQTPAPTP-------MPEQ--SWQTPAPTPMperswqt-------paptpmpEQSwqtPAPTPMpeRSWQT--- 383 Antheraea pernyi nu...
Q91GG2   354 --------LPKHTHKRGKRTFDEETvpNLQQP------------------------------------------------ 377 Epiphyas postvittan...
ABL76033 401 ERLPinfLDTFAISSVRDKKSAASDSLPTRSMKRARANNEQDVD---------------------EDDDD---------- 449 Maruca vitrata nucl...
Q2NNY4   342 EMFP---SDLSLQSQKESSSSNGSTVGGFTRRRRRRAPPLPELS---------------------SEEEEdppknvnqqm 397 Hyphantria cunea nu...
O41446   316 QKFPeieSSLPENVSLPDSSDEEPFIG--QRKRRRHVRPLTPYSprttlgnessqdneprrrdsySTEKEsktpnnella 393 Choristoneura fumif...
ABQ12280 384 ----------------PAQDQNLQAPVPNADAKRRRVPS--------------------------SDEEE---------- 411 Antheraea pernyi nu...
Q91GG2   378 ----------------PNRQKSSSN----EKRKRRISRKL-------------------------SSEDE---------- 402 Epiphyas postvittan...
ABL76033 450 DDDDVKEVDYEKESKRRKLEDEDFLKLKALEFSKDL-VNERLQKIIVVTDGMKRLYEYCNCKNSLETLPSAANYGSLLKR 528 Maruca vitrata nucl...
Q2NNY4   398 YSSEEDEPDKELARKRRREEDKNYLRLKALELSKYAgVNERMEKIVQVTKAMQQTYDYCNCKNTISGTPSAVTFVQLLRR 477 Hyphantria cunea nu...
O41446   394 PSSDEDEPDHERERKRRREEDKNFLRLQALKLIEYAnVNERMEKIVQVTRAMQKTYDYCNCKNTISGTPDAANFVNLLRR 473 Choristoneura fumif...
ABQ12280 412 -----VEVDFEAERKRRRQEDKDFLRVKAKELAQYAgVNERMERIVKVTRAMQRTYDYCNCKNTIKGTPDAATFEKLLQR 486 Antheraea pernyi nu...
Q91GG2   403 -----QNKDDDEDLIRRREEDKNFLHLKALELSKYAgVNERKEKIVQVTKAMQEMYDYCNCRSTINGPPTAVAFEKLLKH 477 Epiphyas postvittan...
ABL76033 529 LNMYNLDHIEMNVNFYELLFPLTLYNDNDNndktlshQLVNYIFLASSYFQNCAKNFNYMRETFNSFGPFKQIDFMVMFV 608 Maruca vitrata nucl...
Q2NNY4   478 LNTYNLSHVEMTVNFYELLYPLTLYDDESN-------RIVSYIFAATNYFQNCAKNFGNMRVDFNKYGPFPQIDSLVMFV 550 Hyphantria cunea nu...
O41446   474 LNTYNLSHVEMTVNFYELLYSLTLYNDESN-------SIINYIFAAAKYFQNCAKNFVRMRAEFNAHGPFAQIESMVMFV 546 Choristoneura fumif...
ABQ12280 487 LNTYDLAHVEMTVNFYELLYPLTLYNDEDN-------RIAGYIFAAANYFQNCAKNFGQMRAQFNAHGAFAQIDSMVMFV 559 Antheraea pernyi nu...
Q91GG2   478 LNMYNLNHVDMNVNFYELLYPLTLYNDESS-------RIISYIFASANYFYNCAKNYEILRVEFNKYGPFAQIDSMVMFV 550 Epiphyas postvittan...
ABL76033 609 IKFNFLCDMRNFAKLIDDLVPNRQPNMRVHSVLLMRDKVVKLAFSILQFHTFSKKDKSRNTKHLQRLIMLMNANYNII 686 Maruca vitrata nucleo...
Q2NNY4   551 IKFNFLCDLQAFFGKIDTLPMLAQPNIKVHTVLVMRDKIVKLAFNELQYDTTLKTDNRRDPKHLQRLIQLMNADFNVI 628 Hyphantria cunea nucl...
O41446   547 IKFNFLCDLQAFFGKIDSLPTLGQPNMNIHTVLVMRDKIVKQAFNALQYDTTPKIDNRRDPKHLQRLIQLMNADFNII 624 Choristoneura fumifer...
ABQ12280 560 IKFNFLCDLQAFFGQIDNLPTLGQPNIKTHNVLIMRDKIVKLAFNALQYNTVVKTENRRDPKHLRRVIMLMNADFNVI 637 Antheraea pernyi nucl...
Q91GG2   551 IKFNFLCDLRTFFGQLDNIPTLAYPKPAIHNVLIMRDKIVKLAYNALQYNMVAKSEIRNDPKHLQRIIMLMNADFNII 628 Epiphyas postvittana ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap