Conserved Protein Domain Family
Hs1pro-1_N

?
pfam07231: Hs1pro-1_N 
Hs1pro-1 N-terminus
This family represents the N-terminus (approximately 180 residues) of plant Hs1pro-1, which is believed to confer resistance to nematodes.
Statistics
?
PSSM-Id: 399899
View PSSM: pfam07231
Aligned: 9 rows
Threshold Bit Score: 188.626
Threshold Setting Gi: 573914748
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN09734       1 MVELKWKNQMAEQRel------nSATNHrKPIASdsmPVH----HNFVEDSADPlkl-----------nqsDCLAYEQYL 59  Amborella trich...
XP_009133396   1 MVDMDWKRKMLSSEl--------SSKLH-VTIPS---PFKvp-vSSPISCSAPA-----------------ACSAYELYL 50  field mustard
Q9LY61         1 MADLDLQRKMv------------SPKLH-VTIPE---PCKlssvSSPISSSSSA-----------------ACSAYELYL 47  thale cress
O04203         1 MVDMDWKRKMVSSDlpns--pklSSKLH-VTIPS---PFKivpvSSPISCSAPA-----------------LCSAYELYL 57  thale cress
KRH31120       1 MVDLHWKSKMPSSDmpsk-tlklSLSDN-KSLPSlqlPFR----TTDISHAAPS-----------------VCATYDYYL 57  soybean
KRH73164       1 MVDLDWQTKMVHSNimppmspklSLPDHnIPIPTlqlPLR----QNDITAASSP-----------------ICAAYDNYL 59  soybean
XP_002268520   1 MVDLDCTAKMVSPDmpkk-spkfSNKLQ-VSIPS---AFR----AGDLSSAPSP-----------------ECSAYEYYL 54  wine grape
XP_002526872   1 MVDLNWNAKMVSSDlsnk-spklSNKLH-VTIPSt-tPFRgvsnISPVSASDSA------------------CAAYDHYL 59  castor bean
XP_006645040   1 --MATPKLSAvst--------vrPDDK----------QRA----ASSSAAAVSVaplirvqddtaieeyeqYLRLPELAR 56  malo sina
ERN09734      60 HLGRLWALSRSRQFPEWRNEPLLKPSLQALEITFRFISLVLSDPRPYINKSEWKRRLESLACLQIELIASICEDDEDDRE 139 Amborella trich...
XP_009133396  51 RLPELKKLWSSREFPQWNDEPILKPALQALEITFRLVSSVCSDARPYTNHREWNRRLDSLVTNQIQLIAVICEVEDEEED 130 field mustard
Q9LY61        48 RLPELRNLWSSLYFPHWISEPVLKPALQALEITFRLILTVASDTRPYINRREWIRRLDSLTTSQIKIVAAICGDEDNYEE 127 thale cress
O04203        58 RLPELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITKQIQLVAAICEDEEEEGI 137 thale cress
KRH31120      58 RLPQLRKLWNSSDFPNWNNEPILKPILQALEITFRFLSIVLSDPRPYSNHREWTRRIESLITHQIEIIAILCEDEEQNSD 137 soybean
KRH73164      60 RLPELRALWASKDFPNWANEPILKPALHALEITFRLLATVFSDPRPYINKREWTRRVESLATAQIQIIAMLCEDEEENPE 139 soybean
XP_002268520  55 RLSELKKLWDSREFPNWKNESLIRPALQALELTFRFVSTVLSDPRPYANRREWKRRLESLTTNQIQLVAILCEEEEEEGE 134 wine grape
XP_002526872  60 RLPELRKLWNSKDFPDWENESVLKPALHALEITFRFVSTVLSDPRQYTNRKEWKRRIESLATSQIEIISLLCEDEQDDVE 139 castor bean
XP_006645040  57 LWKDRCCPEWADEGLVKPALQALEITFRFVSVALSDRGGYASRRELARRLEALAAREVELVATLCEGERCAPLAEL---- 132 malo sina
ERN09734     140 NIascSAPTVNlhlsngvltrggslqevwkingassalvsQTSEQSLLPRLGAWQKSQDIASKLWFSIE 208 Amborella trichopoda
XP_009133396 131 ER---SAPLGD-----------------------------KRSSLSLLPHLATWRKSEALGRKILCTID 167 field mustard
Q9LY61       128 NVs--AAPVSN-----------------------------GWSSLSLLSEIATCRTSESVGQKILSTIE 165 thale cress
O04203       138 SA---EAPVGG-----------------------------GRSSLSLLPQLATWRRSEALGKKILYTID 174 thale cress
KRH31120     138 TRg--TAPTADlsrnn-------------------ssesrSYSEASLLPRLATWYKSKDVAQRILLSVE 185 soybean
KRH73164     140 TRg--KAPVTDingft--------------------gqsrSYSEESLLPRLATWQKSKDVAQRILNSVD 186 soybean
XP_002268520 135 MRg--TAPISDlslsngvlardgsc-aevwkvpgatpvvsRTSEASLLPRLATWPKSEDIAQKIMYSIE 200 wine grape
XP_002526872 140 IRg--TAPIVDlsssngvlarggsy-aevwkvspettvvnRTSESSLLPRLATWQKSEDIALKILYSIE 205 castor bean
XP_006645040 133 -----SASEGVlprersasevwqlpgsatavvcqvseaslLPRLAAWDKSETVAAKIKYAIESQMQGCV 196 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap