3JA7


Conserved Protein Domain Family
Peptidase_S80

?
pfam07230: Peptidase_S80 
Click on image for an interactive view with Cn3D
Bacteriophage T4-like capsid assembly protein (Gp20)
This family consists of several bacteriophage T4-like capsid assembly (or portal) proteins. The exact mechanism by which the double-stranded (ds) DNA bacteriophages incorporate the portal protein at a unique vertex of the icosahedral capsid is unknown. In phage T4, there is evidence that this vertex, constituted by 12 subunits of gp20, acts as an initiator for the assembly of the major capsid protein and the scaffolding proteins into a prolate icosahedron of precise dimensions. The regulation of portal protein gene expression is an important regulator of prohead assembly in bacteriophage T4. This family represents the protease responsible for the proteolysis of head proteins, a critical step in the morphogenesis of many tailed phages, Cleavage facilitates the conversion of the prohead to the mature capsid. All these cleavages are carried out by action at consensus S/A/G-X-E recognition sequences at 39 cleavage sites. Evidence of multiple processing sites in nine phiKZ proteins appears to represent a built-in mechanism by which the phage ensures that the majority of the propeptide regions are removed, and emphasizes the essential nature of processing in phiKZ-head morphogenesis. The family is classified by MEROPS as a serine peptidase.
Statistics
?
PSSM-Id: 399898
View PSSM: pfam07230
Aligned: 2 rows
Threshold Bit Score: 830.409
Threshold Setting Gi: 75081958
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JA7_K   5 ELIDTYRNLMNNYEVDNAVSEIVSDAIVYEDDTEVVALNLDKSKFSPKIKNMMLDEFSDVLNHLSFQRKGSDHFRRWYVD 84  Escherichia virus T4
Q6WHE6  63 ELIKSYRALAEYHEVDDAIQEIVDEAIVYENDKEVVWLNLDNTDFSENIKAKINEEFDRVVSLLQMRKHGYKWFRKWYVD 142 Vibrio phage KVP40 Ja...
3JA7_K  85 SRIFFHKIIDpkrPKEGIKELRRLDPRQVQYVREIITETEAGTKIVKGYKEYFIYDTAhesyacDGRM-------YEAGT 157 Escherichia virus T4
Q6WHE6 143 SRIYFHKILD---KDNNIIELRPLNPMKMELVREIQKETIDGVEVVKGTLEYYVYKQS------DYKMpswmsatNRAQT 213 Vibrio phage KVP40 Ja...
3JA7_K 158 KIKIPKAAVVYAHSGLVDCCGKN--IIGYLHRAVKPANQLKLLEDAVVIYRITRAPDRRVWYVDTGNMPARKAAEHMQHV 235 Escherichia virus T4
Q6WHE6 214 SFRIPKDAIVFAHSGLMRGCADDpyIIGYLDRAIKPANQLKMLEDALVIYRLARAPERRVFYVDVGNLPTQKAQQYVNGI 293 Vibrio phage KVP40 Ja...
3JA7_K 236 MNTMKNRVVYDASTGKIKNQQHNMSMTEDYWLQRRDGKAVTEVDTLPGADNTGNMEDIRWFRQALYMALRVPLSR-IPQD 314 Escherichia virus T4
Q6WHE6 294 MQNVKNRVVYDTQTGQVKNTTNAMSMLEDYYLPRREGSKGTEVSTLPGGQSLGDIEDVLYFNRKLYKAMRIPTSRaASED 373 Vibrio phage KVP40 Ja...
3JA7_K 315 QQGGVMFDSGTSITRDELTFAKFIRELQHKFEEVFLDPLKTNLLLKGIITEDEWNDEINNIKIEFHRDSYFAELKEAEIL 394 Escherichia virus T4
Q6WHE6 374 QTGGINFGQGAEITRDELKFTKFVKRLQTKFETVITDPLKHQLIVNNIITEEEWDANHEKLYVVFNQDSYFEEAKELEIL 453 Vibrio phage KVP40 Ja...
3JA7_K 395 ERRINMLTMAEPFIGKYISHRTAMKDILQMTDEEIEQEAKQIEEE 439 Escherichia virus T4
Q6WHE6 454 NSRMNAMRDIQDYAGKYYSHKYIQKNILRLSDDQITAMQSEIDEE 498 Vibrio phage KVP40 Japan/Matsuzaki /1991
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap