Conserved Protein Domain Family
PHD_Oberon

?
pfam07227: PHD_Oberon 
PHD - plant homeodomain finger protein
PHD_oberon is a plant homeodomain finger domain of Oberon proteins from plants. Oberon is necessary for maintenance and/or establishment of both the shoot and root apical meristems in Arabidopsis. Oberon proteins are made up of a PHD finger domain and a coiled-coil domain. The PHD-finger domain is found in a wide variety of proteins involved in the regulation of chromatin structure. Oberon proteins mediate the TMO7 (the direct target of MP) expression through modification of, or binding to, chromatin at the TMO7 locus. TMO7 stands for the target of Monopteros 7 (MP) (or Auxin response factor 7).
Statistics
?
PSSM-Id: 399895
View PSSM: pfam07227
Aligned: 30 rows
Threshold Bit Score: 141.315
Threshold Setting Gi: 75337684
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEF45286     155 AGNKKCRSLMvqeenppvaampcdicCSEPRFCRDCCCILCSKiTSSKYGGFGYIKCealv-segYICGHVAHVDCALRT 233 castor bean
Q9LHF5        49 CKNASCRANV----------------PKEDSFCKRCSCCVCHN-FDENKDPSLWLVCepeksddvEFCGLSCHIECAFRE 111 thale cress
EMS52775     142 CRNIACRAIL----------------SMEDKFCRRCSCCICFK-YDDNKDPTIWLSCssdhpmqkDSCGLSCHLECALKD 204 Triticum urartu
KRH16856     145 CQNVACKATL----------------NPEDSFCKRCSCCICHH-YDDNKDPSLWLTCssdl-pneESCGMSCHLQCALSN 206 soybean
EEF48634     150 CQNIACKATL----------------SPGDAFCKRCSCCICHY-YDDNKDPSLWLTCgsdt-ldeKSCGLTCHLICALKN 211 castor bean
XP_002302371 150 CENAACGATL----------------SPGDAFCKRCSCCICHY-YDDNKDPSLWLTCgsds-lgkRSCGLTCHLICALKD 211 black cottonwood
XP_003549399 141 CKNSACKATL----------------NQSYAFCKRCSCCICHQ-YDDNKDPSLWLICssenpfpgVSCGLSCHLECALKH 203 soybean
Q9SUM4       146 CKNLACRAVL----------------RQEDSFCRRCSCCICRK-YDDNKDPSLWLTCssdppfegESCGFSCHLECAFNT 208 thale cress
AFD98847     141 CKNLACRAKL----------------SGQDAFCKRCSCCICRN-YDDNKDPSLWLICsseppfqgDSCGMSCHLECAMKH 203 tomato
XP_019072276 106 CQNLACRASL----------------SPEDAFCKRCSCCICHQ-YDDNKDPSLWLTCssgspnkdDSCGMSCHLTCALKH 168 wine grape
EEF45286     234 YMAGTV--GGSIGLDIEYYCRRCDAKTDLIPHVMRLLQTCESIDSCEQVEKMLALG 287 castor bean
Q9LHF5       112 VKVGVIalGNLMKLDGCFCCYSCGKVSQILGCWKKQLVAAKEARRRDGLCYRIDLG 167 thale cress
EMS52775     205 GRTGILpsGQCKKLDGAYYCPNCRKQHDLLRSWKKQLMLAKEARRLDILCYRIFLG 260 Triticum urartu
KRH16856     207 QMSSILkgSCGIKLDGAFCCVSCGKINELMKTWWKQLLVAKEARRTDILSLRISLA 262 soybean
EEF48634     212 EGTGIMktGCHAKLDGSFYCISCGKINGLMRTWKKQLLIAQEARRVDALCLRVLLG 267 castor bean
XP_002302371 212 ERTGIMkiGCHSKLEGSFYCASCRQVNELMRNWRKQLLVAKEARRVDVLCQRVLLG 267 black cottonwood
XP_003549399 204 DGSGIAkdGEHPKLDGGFYCVSCGKVNDLLGCWRKQLMVAKDTRRVDILCYRVSLS 259 soybean
Q9SUM4       209 EKSGLG--KDKQSEGCCFYCVSCGKANSLLECWKKQLTIAKETRRVEVLCYRLFLV 262 thale cress
AFD98847     204 GKSCITtdKSDKGNNGTFYCVSCGKANDLLSSLKKQLIVARDTRRVDILCYRLSLS 259 tomato
XP_019072276 169 ERTGITknGCRPKLDGEFYCASCGKINGLLRTWRKQLMVAKEARRVDVLCLRVFLS 224 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap