Conserved Protein Domain Family
DUF1421

?
pfam07223: DUF1421 
UBA-like domain (DUF1421)
This domain represents a conserved region that has a UBA like fold. It is found in a number of plant proteins of unknown function.
Statistics
?
PSSM-Id: 399892
View PSSM: pfam07223
Aligned: 12 rows
Threshold Bit Score: 61.6545
Threshold Setting Gi: 223550463
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009109102 448 YGELIEKLMSMGFRGDH-VMAVIQRMEESGQAIDFNALLDRLSvQS 492 field mustard
XP_002517918 483 YSELIDKLVSMGFRAEH-IVGVIQRMEESGQPLDFNAVLDRLS-NS 526 castor bean
XP_004232320 490 IDDVVDKVTNMGFPRDQ-VRATVRRLTESGQTVDLNTVLDKLMnDG 534 tomato
EEF51950     444 VDDVVDKVVGMGFRRDT-VRATVKKLTENGQSVDLNVVLDKLMnNG 488 castor bean
BAH20220     483 VDDVIDKVVSMGFPRDQ-VRGTVRTLTENGQAVDLNVVLDKLMnGD 527 thale cress
XP_003567907 483 V-DMADKAARMGYLNDQ-VESMAPRMVTAGQPVEFNTFHDGLSsCG 526 stiff brome
EMS64546     607 A-DMADKAARMGYLNDH-AENMPRRMVAAGQPVEYNTFHDGLSsVG 650 Triticum urartu
KQK09143     484 FGNMFETGSVVGYPQDR-VGSMTLPVVSAARPADSGVIADKLNaGS 528 stiff brome
EES18674     466 V-DIAEKVARMGYSKDQ-VEGLALRMVAAGQPAEYNHLHDRLSsVS 509 sorghum
AQK88430     467 I-GIADKVARMGYPKDQvVDGLALRMVDAGQPAECNTLHDRLSsVT 511 Zea mays
XP_006376495 477 YNDLIEKLVNMGFRGDH-VVSVIQRMEEGGEPVDFNSVLDRLKvHS 521 black cottonwood
XP_003543336 486 YNDLIEKFVSMGFRGDH-VANIIQRMEETQLPIDFNSVHDRLDvHN 530 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap