Conserved Protein Domain Family

pfam07220: DUF1420 
Protein of unknown function (DUF1420)
This family consists of several hypothetical putative lipoproteins which seem to be found specifically in the bacterium Leptospira interrogans. Members of this family are typically around 670 resides in length and their function is unknown.
PSSM-Id: 115849
Aligned: 2 rows
Threshold Bit Score: 1084.18
Threshold Setting Gi: 75405447
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
ADC93892 642 VARNPFNRNDFFTVILVEFQSDKLPQCANFIL 673 Leptospira interrogans serovar Canicola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap