Conserved Protein Domain Family
DUF1420

?
pfam07220: DUF1420 
Protein of unknown function (DUF1420)
This family consists of several hypothetical putative lipoproteins which seem to be found specifically in the bacterium Leptospira interrogans. Members of this family are typically around 670 resides in length and their function is unknown.
Statistics
?
PSSM-Id: 115849
View PSSM: pfam07220
Aligned: 2 rows
Threshold Bit Score: 1084.18
Threshold Setting Gi: 75405447
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ADC93892   4 MKFGLDANVAYPPLSVLYSIFLIFGCDFLGFYILKLFESSLGKVKNTWIRWQAPLIGALLLSVILYPLALSALTPRFLMK 83  Leptospira interrog...
Q8VTZ1     1 MKFGLDANITYPPLSVIYSILLILGCDFLGFYILKLFENHLGEIKNTWRRWQAPLTGALLLSVSLYPLALFGFTSRLFME 80  Leptospira interrogans
ADC93892  84 SAAIFLSVLGCANICFFVKNGTKNLVSISYYS-NIFKSIQYHSFFEKigndKKIKKSFSLFKLIGFIKNKFNLINKNDVL 162 Leptospira interrog...
Q8VTZ1    81 SVAFLLVILGLINLGGFIKKIKSNKDILNISKqNLDRSLNFNIQTDL----EQQKRPFFLFKEKYSFMDKFALIDINKFL 156 Leptospira interrogans
ADC93892 163 NVFIILLMIGYGFLALCPITNADSLDYHIGVAIEILNQGKMPVFSGWFHGRLAGSGEVLNALGLAIGAEQFGSLLQFCGL 242 Leptospira interrog...
Q8VTZ1   157 NLFIKLLLVAYGLLALCPVTNADSLDYHIGVAIEILNQGKMPAFLGWFHGRLAGSGEVLNALGLAIGAEQFGSLLQFSGL 236 Leptospira interrogans
ADC93892 243 LSIYGILSFYSFAEKFSESDG-VWRKIIIIAFLSSPVLVFLVSSPKPQLLQIGMTSFAITLLLEIFSKIKTDKNKLFAFS 321 Leptospira interrog...
Q8VTZ1   237 LGIYGILAFYSFLEKNLANDGsVWREIIIIAFLSSPVLVFLVSSSKPQLLQVGMTSFAVVLLLEIISKAKTDKNKLSIFI 316 Leptospira interrogans
ADC93892 322 LICILIMSATQAKFSFFLSAFLIGLFSIFSLGSIRLFFYGLLISLFFFVLINFPAIFWKIKNYNSTFIDVLIHPLPGnTF 401 Leptospira interrog...
Q8VTZ1   317 LICILIMSTTQAKFSFFLSAFLIGLCSLILLGSIRLYIYGVLIGIFFLILIIFPSVFWKIKNFDSSMIDAILVPLPG-PW 395 Leptospira interrogans
ADC93892 402 PGVNEFEVSLRNYQDSALIFPLSLIFPNQFGVITTVIGLGLFLIIFVKPIVTQKAFLLSVMIILFVILGSLMGQKASRFF 481 Leptospira interrog...
Q8VTZ1   396 PGVRSFESVLRNYRDSTLDFPLSLLIPNTFGVVTTIIGSGLFLVIFVKPIANLQTFVLSFIIIIFVILGILLGQNASRFF 475 Leptospira interrogans
ADC93892 482 LEPFVWMLISLIGLNSFGKWNIRFVKEAVSTGILLQACATLVIISVGIYQLFPGVFSISLREKVMSQYANGYSLMKWVGL 561 Leptospira interrog...
Q8VTZ1   476 LEPFIWILISLIVIDPIKIQNLKFTRNVIGFLVILQAGLTFGILLLGIYQLLPGVFSIQSREKVMNQYSNGYNLMKWTGS 555 Leptospira interrogans
ADC93892 562 TLPKEAVLLSQHRSIALSERKTLSLDWIPFVDFNSAVASPYLKQIKDENVTHILMFGDTSKNTPFSGCIGNTIGKTKSNQ 641 Leptospira interrog...
Q8VTZ1   556 VLPKDAVLLSQHRSVALSERKTLSLDWAKFVNFDSIIASPYLREIKDENVTHILILGEISKDSPFFGCIGNVIGKTKSQI 635 Leptospira interrogans
ADC93892 642 VARNPFNRNDFFTVILVEFQSDKLPQCANFIL 673 Leptospira interrogans serovar Canicola
Q8VTZ1   636 AMRNPLAPKDHFTAILAEFRINNLSQCSNSVL 667 Leptospira interrogans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap