Conserved Protein Domain Family
DUF1418

?
pfam07214: DUF1418 
Protein of unknown function (DUF1418)
This family consists of several hypothetical Enterobacterial proteins of around 100 residues in length. Members of this family are often described as YbjC. In E. coli the ybjC gene is located downstream of nfsA (which encodes the major oxygen-insensitive nitroreductase). It is thought that nfsA and ybjC form an operon an its promoter is a class I SoxS-dependent promoter. The function of this family is unknown.
Statistics
?
PSSM-Id: 369264
View PSSM: pfam07214
Aligned: 6 rows
Threshold Bit Score: 109.846
Threshold Setting Gi: 1175574
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAL19981          1 MRSLGNMPRIVIISEVLGLLLLVVAYLSINNYLSLPGEMGTPTAAIMMIFVGVGLMIPAAVCIVWRVASGFGPLLgsadR 80  Yersinia pes...
AHG21911          1 MLSFGNLPRSVLVLEGLGMVLLVLSYLSIHNYVHLPGPLASQQAAIGMIFLGVTLMLPAVVYLVWRLVQGFNPLI----R 76  Chania multi...
P46119            1 MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQILMIFLGVLLMLPAAVVVILQVAKRLAPQL----M 76  Escherichia ...
wugsc:CKO_02257   1 MRSISALPKSVLILEILGMILLAAALLSLNQYLTLPAPMNSPLAVTVMIFLGILLMLPAAVALMWRIAQLIAPQL----M 76  Citrobacter ...
Q8ZQK2            1 MRTIGVLPKSVLILEYLGMILLALALLSLNHYLTLPAPFNTPLAGVLMVFLGVVLILPAAVAMMWRIAQLLAPQL----M 76  Salmonella e...
CCH:MU9_1500      9 MRSLGDMPRPVIICEVIGVILLVLVYLAVNDFISLPGFMSSKNALMVMAFAGLGCLVPAAINIVWRAISAMPSVGi--dS 86  Morganella m...
CAL19981         81 ISTPQKASEEKLAAKSKK 98  Yersinia pestis CO92
AHG21911         77 EQQPPENTQRNPSPADKK 94  Chania multitudinisentens RB-25
P46119           77 NRPPQY-SRSEREKDNDA 93  Escherichia coli K-12
wugsc:CKO_02257  77 TRSPDSSSRSAREKPHDS 94  Citrobacter koseri ATCC BAA-895
Q8ZQK2           77 KRPPDISSRSDREKHNES 94  Salmonella enterica subsp. enterica serovar Typhimurium
CCH:MU9_1500     87 KSGPDKKTRQKKNEKkq- 103 Morganella morganii subsp. morganii KT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap