Conserved Protein Domain Family
DUF1411

?
pfam07199: DUF1411 
Protein of unknown function (DUF1411)
This family represents a conserved region approximately 150 residues long that is sometimes repeated within some Babesia bovis proteins of unknown function.
Statistics
?
PSSM-Id: 369258
View PSSM: pfam07199
Aligned: 6 rows
Threshold Bit Score: 270.213
Threshold Setting Gi: 156084598
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q17112         1 MSGHLVCKSGFSLGRVAKLMLASLVVLSAFSDGVLAwflggVPIDASRKPQPASVDGWWFTKgeyevdpewndadIVYDD 80  Babesia bovis
EDO06243       1 MSGHLVCKSGFGLGKVAKLMLASVVVLSAFSGNVWA-----NEAEVSQVVKPGSVNGWWFTKgeydvdpewneadIVYDD 75  Babesia bovis
EDO06238       1 MSGHLVCKSGFGLGKVAKLMLASVVVLSAFSGNVWA-----NEAEVPQEPVEKKKEGGKGSWfwk-------kgdSEKED 68  Babesia bovis
XP_001609780   1 MSGYLVCKSGFGLGKVAKLMLASVVVLSSLSTNVWA-----DKAEAPKKPVEKKKEGGLSSG-------------SSKEN 62  Babesia bovis T2Bo
XP_001609782   1 MSGHLVCKSGFGLGKVAKLMLASFVVLSAFSGRVLA---------------------GCLGG------------------ 41  Babesia bovis T2Bo
EDO06213       1 MSGYLVCKSGFGLGKVAKLMLASVVVLSSLSTNVWA-----DEAEVPQEPVEKKKESGCFSW---------------SWE 60  Babesia bovis
Q17112        81 YKKY--SAFSDIDITESTEKTSLGDIFMKIGP-KKCMNLRVKDVDVDMQRANRRLATILQQITNHTPDSPMFAVSENIVK 157 Babesia bovis
EDO06243      76 YKKY--NGFSDMDKTESTEKTSLGDIFMKLGP-KKCMNLRVKDVDVDMQRANRRLATILQHITDHTPESPMFAVSENIVK 152 Babesia bovis
EDO06238      69 LQKLppKNIPSITTSSNTEKTPLKDFSVTLGPaKRCCAPWLKKGEVDLSMLKKRISLLLHRVTNYGPGTPGFGISENIVE 148 Babesia bovis
XP_001609780  63 SQKLppQNYPSIITTNNTEKTSLNDLSVSIGPaQNSYLFWIKKGDVDLSVLKERISVLLNIVTNYGPGTPGFGISENIVE 142 Babesia bovis T2Bo
XP_001609782  42 NNKL----LFDLTKTDNTEKTPLSDISVKLSGiDKSM----KNVDVDMELLNQRITVLLRHLTSCGPDSPDFGTSENIVK 113 Babesia bovis T2Bo
EDO06213      61 KSKL----LFDLTKTDNTVKTQLSDVSVKLCDiENSM----KNVDVDMELLNKRITVILKHLTSCGPDSPDFGTSENIVK 132 Babesia bovis
Q17112       158 ALNKQHTIELPKALAQQLSQFDAKAMKTDESRQFKDAFSTFFADFVAD 205 Babesia bovis
EDO06243     153 ALNKQHTIELPKALAQQLCQFDAKAMKTDESRQFKDAFSTFFADFVAD 200 Babesia bovis
EDO06238     149 LFNNKGTIVVPEDIARDLCRLPSGKAMLYEWKCFTDEFARYIAEMLTV 196 Babesia bovis
XP_001609780 143 FFNKRGSIDVPEDIARDLCRLPSGKMILYSWTCFTDMFARFIAELLTV 190 Babesia bovis T2Bo
XP_001609782 114 VLNKKGEIEIPKRLAQSLCQMKTGKTSRYEWGVFSDELITLLFHLAID 161 Babesia bovis T2Bo
EDO06213     133 VLNKKGEIELPKRLAQLLCKMETGKTRRYEWAEFRDKFVSILGHMMVN 180 Babesia bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap