Conserved Protein Domain Family
DUF1404

?
pfam07185: DUF1404 
Protein of unknown function (DUF1404)
This family consists of several archaeal proteins of around 180 residues in length. Members of this family seem to be found exclusively in Sulfolobus tokodaii and Sulfolobus solfataricus. The function of this family is unknown.
Statistics
?
PSSM-Id: 369252
View PSSM: pfam07185
Aligned: 16 rows
Threshold Bit Score: 121.99
Threshold Setting Gi: 342306741
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAK54830           10 IFGFVLIIASINPLSLMLANQLEIARFSFDMLLVWGAGLIGVYLAKLmyskgDEISksILslnyktkgvlyswgIGGALL 89  Sulfurisph...
Q976Q2             14 IFPLVLLIIFLNPVVESYETLYQWLFMLAHYSLFIGGLLLTYRLIKG-----TPFL--II--------------PSGVIA 72  Sulfurisph...
WP_012021446       13 vAGILLLVFALNPLTELEEFKLEPLFMASHYALFIGGFLL-TMGRKY-----SRLL--VV--------------PAIFLV 70  Metallosph...
RogerUC:Ahos_0957  14 IIPVLFLIVAINPVTELLEPRYEALYMAMHYVLYIGGFVLGYIGFRG-----SKIY--LI--------------PGIIIP 72  Acidianus ...
WP_011921471        7 aLGLILAVVGLNPATEELEFHSATAYMLSHYAVVSSGFILGYLLLRN-----DWKF--SV--------------IGVVPV 65  Metallosph...
WP_011921470        7 FLGIFLTLLIVNPLFEKIYGKNAVLYMASHYALFALGMWIGLAMVSR-----KYWVgkLV--------------VGSGLA 67  Metallosph...
Q97UM9             11 MFCIFLIAISVNPFTEEYMFVNPIPYMLAHYSLFGAGILISYYLVKRki-vdKHIG--FP--------------VGASIA 73  Saccharolo...
Q4J6N1              9 IISVFLIIITINPYTETYMSINPIPYMLAHYSLYASGILLAYFVYDRlkplnKYIS--LV--------------IGIFLA 72  Sulfolobus...
Q976T7              7 YL-LPLDMFLILPFTFSFLSYSPAIPMLFHYLILGISIFLSNKFYSL-----SRKF--LF--------------IALPII 64  Sulfurisph...
jgi:Msed_0292       1 MASVALIVLTVNPFTLEALPKNPLVLMASHYSLYFAGALAGLGLFRF-----NKLL--AI--------------PAVIPP 59  Metallosph...
BAK54830           90 TLWYLPNFFDLSVISTEFRVLQILSFIIAGIFGGIGWDALGKAMRsFTLFSMFSMMAAVAELFLEMA-GYYSVNYYP--V 166 Sulfurisph...
Q976Q2             73 VFWHLPMYFNLAAAFTSYRILNDLTLVLAGILAGIGSGKLSLLQK-FSLIIVWMTADTAYSIVFLLEnPAYSNVVYSfsP 151 Sulfurisph...
WP_012021446       71 VFWHVPYFYALAGGSAIYRIINDLSLLLAGILAGGSSSSLSFPMK-LLLFVGWMGADSVLSVILIVGwPPYSNQVYPfsP 149 Metallosph...
RogerUC:Ahos_0957  73 VFWHIPYFFNLGGAYLCLRIVEDLSLYLGGLVMGSTIHGLNNAIK-AILFVLWMMGDSVLSVILIVGwPPYSNQVYPfsP 151 Acidianus ...
WP_011921471       66 IFWHLPLPFSLGAGILEFRVLLDVSLLLGGFLLGSSIHALPQWSK-ISLFALYMLGDTVLSILLVIGsPEYSNKVYPfsP 144 Metallosph...
WP_011921470       68 VLAHIPLIFDVSAYSEPVRLILELGLVLGGFLVGSSFQAGGNMVG-YTLLGGWMAGDTALSIAFLLGdSGYT---FPssP 143 Metallosph...
Q97UM9             74 FLWHYPFFFNLGAEILSVRLIEEITLLVGGLIIGSSLKELNRSFK-VLLLALWMIGDSLLSLILMISpSLYTTL------ 146 Saccharolo...
Q4J6N1             73 VTWHIPFFFNLGVYNLWIRLIEELSLFIGGYFMGHSIKGLSRNFN-LFLLALWMIADTYLSALLMIYpSLYTTL------ 145 Sulfolobus...
Q976T7             65 IFWHLPWFFDYATSVYFIWIIDVISMTISGVLIGSSISKFSINFL-VFLFFLWMIGDSLLSYMWIIGfSLYSS---PysI 140 Sulfurisph...
jgi:Msed_0292      60 IVFHLPYFFVESGVSLPWTFVDYSLTVVGGILLGGSMRQMGKVMK-GSLFVLYMIGDTTLAILLILGfPVYSSPTVPfsP 138 Metallosph...
BAK54830          167 YPTYQLVQTSYMLFVMAAVPSTYYMVKVLKD 197 Sulfurisphaera tokodaii str. 7
Q976Q2            152 YTPSQEINTAVVMWIIMSIIIAYIAGKFLKE 182 Sulfurisphaera tokodaii
WP_012021446      150 YSVGQEIVTGLTMFGIMTTVFVVVLFRLLRS 180 Metallosphaera sedula
RogerUC:Ahos_0957 152 FSISEEFWTGLVMFGIMTVIFIYIILGFIRT 182 Acidianus hospitalis W1
WP_011921471      145 YSPESLPLAGIFMIVAMNVILATVIYLAFRS 175 Metallosphaera sedula
WP_011921470      144 YPTWQIKDAGVFMFLLMNVVAFFIIMRIFIR 174 Metallosphaera sedula
Q97UM9            147 YAPKELEYLGIIMFLMMNLIAVYILLNYINN 177 Saccharolobus solfataricus
Q4J6N1            146 YNTQSLQYLGVIMFLMMNTLVVYLLLQYVIK 176 Sulfolobus acidocaldarius
Q976T7            141 YPRYELPAAGSIVFVVMDILGVYILLKLFfa 171 Sulfurisphaera tokodaii
jgi:Msed_0292     139 YSTTQLVEVSYLMFGVMNAILFGVLGYTLKK 169 Metallosphaera sedula DSM 5348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap