Conserved Protein Domain Family
DUF1403

?
pfam07183: DUF1403 
Protein of unknown function (DUF1403)
This family consists of several hypothetical bacterial proteins of around 320 residues in length. Members of this family are mainly found in Rhizobium and Agrobacterium species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399873
View PSSM: pfam07183
Aligned: 11 rows
Threshold Bit Score: 257.003
Threshold Setting Gi: 390189703
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q11AK2         20 AAVPLTAVPAWlrsAVPGAQSVAGNgv-----eDVALAAGAALGTLDAVVR---------------RQERWAGAWRQRLA 79  Chelativorans ...
CCD31936       36 YVMEIQPLPRW---ARLDATACDAL--------AAAFLAGANLLALDQILRsgd----------hgAEPCFSGVLRQRLA 94  Methylocystis ...
CCD32242       36 KDPQIQALPRW---ARAQKADRD----------AAAFVAGAGLALFDQMLRggahgvdlssaaqdpAEPAYAGCLRQRLA 102 Methylocystis ...
jgi:Xaut_4799  10 TTFDPPAVPGW---AIPRAPVEDPA--------EAAYMAGVALNSLDNIMR---------------GEPAWGGAWRQRLA 63  Xanthobacter a...
vbi:Avi_7276   11 plswsPRLPGW---ASLRGRDIPES--------DAAFSAGIALKSLDDLIQ---------------ADPPWLGCWRDRLA 64  Agrobacterium ...
jgi:Oant_4817  15 spawsSRLPGW---ALSRGRAPSDV--------DAAFAAGIALKSLDDLIR---------------ADPPWLGCWRDRFA 68  Ochrobactrum a...
vbi:Avi_9009   15 tltwsPRLPSW---TRPRTHDITES--------DASFAAGIALKSLDDLIR---------------TEPPWLGCWRDRLA 68  Agrobacterium ...
Q11N29         20 TSAPVVTLPGWlrrAVPDAQSLAAKghgpngleEVAIAAGAAIGALDAVVR---------------RQERWAGVWRQRLA 84  Chelativorans ...
Q07GR7         11 DLKTLPKLPGWvtsTRAETLE------------TVAFRSGAALTVLDGLVSd-------------pKHGVPVKLFANHLA 65  Roseobacter de...
jgi:Dshi_3752  11 DRDTLPRMPAWvtsARAETLE------------DVAFLSGAALSQLHLVLG---------------YKEVPQPLLRDRLV 63  Dinoroseobacte...
Q1GLU1         11 DQNRIPFLPSWvtsARAEAPE------------YVSFLSGAALSHLHHAIS---------------LDEVPMNLVRDRLA 63  Ruegeria sp. T...
Q11AK2         80 LAAAAATTKQAGRLEDEAALRDALLLTkGADDVGPGGQMLWAWRRLTAQPSaeLLTAKTLAAVLQDFGHAR--DDAAVSG 157 Chelativorans ...
CCD31936       95 LKAAAICARLARLREDAAALRDAEHLS-GGVETSPAGRVHRLWRLFASRAV--KFDAATLSLAIEYLEAQDvvDVRELAD 171 Methylocystis ...
CCD32242      103 LKAAESCVTLSRLREDATALRDAEHL--AGGEPSPAGRLHRLFRIDAARPA--RLHAAALAAALSLLGLPEt-DADALAQ 177 Methylocystis ...
jgi:Xaut_4799  64 LRAAAATARLLGHREDEAALRDAWHLRpPGADPGPAGNVLAAWRRLAARSP--VIDVDGLRAIVGLLGLAW--S-DGLAA 138 Xanthobacter a...
vbi:Avi_7276   65 LKSAAIAARMDGRSEDEHALRDALLLTaPGDDPGPAGKLFLATRMLSRRSG--AITTPFIQELAALLDLCW--D-EGLAS 139 Agrobacterium ...
jgi:Oant_4817  69 LKSATVAARMFGRSGEETAIRDAVLLTgSGDDPGPAGKLFLATRMLVRRTG--TITTPFVRELATLLGMKW--D-DGLAS 143 Ochrobactrum a...
vbi:Avi_9009   69 LKSAAVAARTLGRNEEETGIRDAVLLTsAGDDPGPAGKLFLATRMLARQSG--TVTTPFVKELVALLGMKW--D-DSLAS 143 Agrobacterium ...
Q11N29         85 LAAAAVTTRQAGRVEDEAALRDAVLLTrPGDDVGPAGRVLLAWRRLAARPAeeLLTEASIAGVLDALGLAR--DDEAAAD 162 Chelativorans ...
Q07GR7         66 LKAATATSKLEGRLAREADIRDAYYLTpPGEARGPDGDLLAFWREAAQMRMssREWQAELRGLV---------GPDAVAE 136 Roseobacter de...
jgi:Dshi_3752  64 LRAAEACVAFSGRPERVGELRDAVYLLrPGDLPGPAGETYLAWQRAAERPVsiKV------------------LDRALPT 125 Dinoroseobacte...
Q1GLU1         64 LRAAEVTVAFAGRHETAAELRDAVHFLePGDLPGPAGEIYLSWQRAVRRPVqaNA------------------LHKGLGS 125 Ruegeria sp. T...
Q11AK2        158 LADELRQLAGNSGTLGVLTGALMA--AERHC--FGRLLGAWLADAVLAQRLGWAHAIPLLGAEPAFS------AGAARSR 227 Chelativorans ...
CCD31936      172 ALRDVMASADNPLAAAASTSAAAGpyLTTLPaiDAEIFALWLADLALAQKLGWQAPVPLLATAVAHPalr-rgPHGRRPR 250 Methylocystis ...
CCD32242      178 ALSGCLADAPDPLSAAARASAVAMklCAAGSaiDAEVFALWVADLALATRLDWARPVPLLASAILHPslr-rgPKGKRPR 256 Methylocystis ...
jgi:Xaut_4799 139 IPALVAEQARATRPAPLVAASVAFevAALGA--QAEVLAWWCADLALAARFRWPFALPILATQIHAPvlr-ggAGRRRIR 215 Xanthobacter a...
vbi:Avi_7276  140 IPDLVDSAIQSERAAPFVAVDLIAamCAIRP--DIEVLALGLADVVLAQKLKWPRPVPLLLPERFGSsfr-tiGGRGRVR 216 Agrobacterium ...
jgi:Oant_4817 144 IPDMVDTTIQSGRLVPLVVAELISamTATRP--DAEVMALGLAETVLAQKLNWPKPVPLLLPERYGPafr-tiGGRGRVR 220 Ochrobactrum a...
vbi:Avi_9009  144 IPEIVDSANQSGRAATFAVADLITaiYAVRP--DAEVMALSLAELVLANKLKWPKPVPLLLPERFGPafr-tiGGRGRVR 220 Agrobacterium ...
Q11N29        163 LADEVRQLAATEGAVGTLVGAFAA--VERRG--LPRTVGSWFADAMLAQRLGWTHAVPLLGGEAAGA------NGSARPR 232 Chelativorans ...
Q07GR7        137 ADNSLTATVAHAKAHGPLAGCVSAmrAVLEVddRGERIACLLSDVVLARALNWTTVLPVSGLRLTKGmlrdlvAD----- 211 Roseobacter de...
jgi:Dshi_3752 126 IEPGQIATWLDAGKGAPVTRAVMVleAVLREapREDLAALILADAALALAIGWDHLVPMLAPGLKRAdlr---------- 195 Dinoroseobacte...
Q1GLU1        126 VSSQLIAQSLAPKGRAPVEHAVSVleECVSDdsIPVVAALILADAALARSLGWARILPVFALGLTTAdlr---------- 195 Ruegeria sp. T...
Q11AK2        228 RAragvavmggekGPHATTNLLAAQARAALRAIDLSSELGRRADRLLAVAPKLRAKGADAIVDRFLNEDALVA----Srg 303 Chelativorans ...
CCD31936      251 LG-----------DRDWSNALASAYALAAGEAMDLAGALSRQTQKLLDAAPKLRAKGAERVIDMMVADDCVAP----Ar- 314 Methylocystis ...
CCD32242      257 PL-----------EVDWSDAVASAYGLAIGDAHALAADLARRAQRLTAIAPKLRARGARHVVDMLLADDAVTP----Aa- 320 Methylocystis ...
jgi:Xaut_4799 216 PG-----------EEGFAGAACVAAAAGGAEACRLAGEIAARAGRLAAATPKLRTKGAGEAIRLLLDDDAVSG----S-- 278 Xanthobacter a...
vbi:Avi_7276  217 PG-----------EPAYPKAICLALVDGVDAALRSTVDINRRAARLLAVAPKVRTKGAEPVIRRLLNEDAVLA----S-- 279 Agrobacterium ...
jgi:Oant_4817 221 PG-----------EPAYPKAICLALVDGVEAALRSAVEIDRRAERLLAVAPKVRTKGAAPVIRRLLTEDAVPA----S-- 283 Ochrobactrum a...
vbi:Avi_9009  221 PG-----------EPAYPKAICLALVDGVEAALRSAVDIDRRAARLLTVAPKVRTKGAEPVIRRLLADDAISA----S-- 283 Agrobacterium ...
Q11N29        233 RAatvlapkgseaDPERGRALLAAQARAAVRAVDQSADIERRAERLIAVAPALRARGADVVVDRLLSDDAIVA----S-- 306 Chelativorans ...
Q07GR7        212 -------------GQGAELKVQQRLLESVEDTIRQARDLSSKSVALKAVAPKLRAKGSDAAVALFLSEGTVAPplmlSpm 278 Roseobacter de...
jgi:Dshi_3752 196 -----------kqGGDLRLACHRALISSVIEAVRQAADLARRAAQLKAVAPKLRAKGAGDAVEMFLTRDAVAP------- 257 Dinoroseobacte...
Q1GLU1        196 -----------krDQSLRLACHQALQVAIIEILRHISECTRGVRNLAAVVPKLRAKGAAGAVEVFLTQDAAAA------- 257 Ruegeria sp. T...
Q11AK2        304 drDKHTGMSDRGLRRLFDRLVALGAVRELSGRPTFRIYGL 343 Chelativorans sp. BNC1
CCD31936      315 -aAKAARLSDRGARRLFDRLIELGAVRELSGRTSFRLYGL 353 Methylocystis sp. SC2
CCD32242      321 --AARAGLSDRAARRLFDRLVALGAVRELTGRETFRIYGL 358 Methylocystis sp. SC2
jgi:Xaut_4799 279 --LTTLTLSRWAARRLFERLHALEAVRELSGRPSFRLYGL 316 Xanthobacter autotrophicus Py2
vbi:Avi_7276  280 --APGSGLSRWAANRLFERLESFEAVRELSGRSSFRVFGV 317 Agrobacterium vitis S4
jgi:Oant_4817 284 --APGSKLSRWAANRLFERLESFEAVRELSGRSSFRIFGL 321 Ochrobactrum anthropi ATCC 49188
vbi:Avi_9009  284 --APDSTLSRWAANRLFERLESFEAVRELSGRSSFRIFGL 321 Agrobacterium vitis S4
Q11N29        307 --AKIAGMSDRSLRRLFERLVEFGAVRELSGRSAFRIYGI 344 Chelativorans sp. BNC1
Q07GR7        279 irGTTIPMTDRAARRFCDRLVELGVARELTGRPTFRLYGI 318 Roseobacter denitrificans OCh 114
jgi:Dshi_3752 258 ---SALPLPDRAARRLCDRLVDLGAVRELTGRDTFRLYGV 294 Dinoroseobacter shibae DFL 12 = DSM 16493
Q1GLU1        258 ---SALPLPDRAARRLCDRLTSLGVLRELSGRDSFRLYGV 294 Ruegeria sp. TM1040
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap