Conserved Protein Domain Family
Osteoregulin

?
pfam07175: Osteoregulin 
Osteoregulin
This family represents a conserved region approximately 180 residues long within osteoregulin, a bone-remodelling protein expressed highly in osteocytes within trabecular and cortical bone. A conserved RGD motif is found towards the C-terminal end of this region, and this is potentially involved in integrin recognition.
Statistics
?
PSSM-Id: 399867
View PSSM: pfam07175
Aligned: 12 rows
Threshold Bit Score: 244.761
Threshold Setting Gi: 240006663
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8K4L6        30 EDrSSCGNQDSIHKDLAASVYPDPTVDEGTEDGQGALLHPPGQDRYGAALLRNITQPVKSLVTGAELRREGNQEKRPQSV 109 house mouse
XP_003414137 129 ED-QSISNKENAYDDLKMPIYPESTRNNGAQNGDDAISKQHEQEEYSAALVRNNMQHLMGPVTVTALLREDDKKKKPRNV 207 African savanna...
XP_019817681  96 ED-YIISSKENAHSDLKMSIYPESKGKHRAEDRDSAIRKLHSQEGYGAALIRNSMYHGMEPRTVTELLGGENKENKPRNV 174 zebu cattle
XP_003985237 129 ED-DTINNKENAHSDQKRYIYPESTGNNGVDDGDNAISKLRDQEEHGTALIRNNMQHIMEPGTVTELLAEENKENQHRNV 207 domestic cat
XP_004756164 129 ED-DSINNQGNAHSDLKMSIYPESTGNKGAEDEDNVVNKFRNQEEYGATLIRNNLQYIMEPRTVTELLAEENKENKPKNV 207 domestic ferret
XP_023493519 122 ED-YRISKKENARNDLKMSTYPESTGNNGAKDGDDAVSKLHDQEEYSAHLLRKNMQHIMEPGTVVELLGEENKENKPRKV 200 horse
ELK13678       3 eD-FSTSNKENAHNNLKVSIYPGSTGNNGAEDGDTVISKLHDQEEYSAALTRNNMQHIMEPGAVTELLGKENKEIKFRKV 81  black flying fox
ELW70200     108 EG-Y-ISKKENTHNDVQMPIYSNATGDQEAEGGDDAASRLHDQEEYGAALTRNQMQHRMGPVTVTKLVGKGSKENKPRNA 185 Chinese tree shrew
EGW12409      22 ED--STNNKGGTNENLTASVYPEPSGDKGAENLEDILRNLPDQERHDAILARSIMQPIKRPVTGIERSGDENKEKKPKTV 99  Chinese hamster
ACS37551      22 EDgSSGGNQGNIH---LASVKPEPTVGKGTEGGRDAPLHLPDQNRQGATLLRNITQPVKSLVTGTEVQSDRNKEKKPQSV 98  Norway rat
XP_003790071 131 ED-YSITNKENVHNDLKMSMYLESPGNNEADNGDDAVIKLHDQEEYSAALIRKNTQPVKGPVAVMKLLGEANKKNKPRNV 209 small-eared galago
BAC11386      98 KE-YSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNV 176 human
Q8K4L6       110 LSVIPADVNDAKVSLKDIKNQESYLLTQSSPVKSKHTKHtrqTRRSThylTHLPQIKKTPSDLEGSGSPDLLVRGDNDVP 189 house mouse
XP_003414137 208 LNKILRGANYAEALPKGKKNHQRHAQAQNIPVQSKSTHR---IQHNR---KQLPKVKTIPSDFEGSGYTNLQERGDNDIS 281 African savanna...
XP_019817681 175 LGKIPADANYAKAPSQ-LKNHQRDSQAQNIPVKSKSTHL---TQHNMdylKQLPKVKKIPSDFEGSGYPDLQGRGDNDLS 250 zebu cattle
XP_003985237 208 LSKIPASVNYVKVPSKDRKNYQRDPQAQNIPVKSKSTRL---TQYNTdysKQLPKLKKIPSDFEGSGYPDLQGRGDNDIS 284 domestic cat
XP_004756164 208 LSKIPASMNYVKVSSKDRKNYQRDSQAQNIPVKSKSTYH---TQHNIdypKQLPKVKKVPSDFEGSGYPDLQERGDNDLS 284 domestic ferret
XP_023493519 201 VSKIPAGASYAKGPSKDKKSHQKDPQAQNIPVKSKSTYR---IQHNTdylKQLPKVKKIPSDVEGSGYPDLQERGDNDIS 277 horse
ELK13678      82 LSKIPTSVSYAKAPLKGQKNHQRDPQAQKIPVKSKSTHH---IQHNTdylKQLSKVKKIPSDFEGSGYPDLQERGSNNMS 158 black flying fox
ELW70200     186 LSRMPAGANHARAHWKGKKNHRRDKQAENSPGDSKSPHH---RQQNTdylKQLPKVKHVPSDFEGSGYTDLQERGDNAFP 262 Chinese tree shrew
EGW12409     100 PSMIPADVRDAKDHLKHTGNQERHLPSQNSPAKSKGTHQ---IRRSThylTHLPQIRKIPSDFEGSGSPDTQVRGDNNVP 176 Chinese hamster
ACS37551      99 LSVIPTDVHNANDYSEDTENQQRDLLLQNSPGQSKHTPR---ARRSThylTHLPQIRKILSDFEDSASPDLLVRGDNDVP 175 Norway rat
XP_003790071 210 LHRIAAGVNYATAHSKDKKNPQRHSQVQNSPVKAKSSHH---IQHNTgslKHPSKVKKIPSDFEGSGYSDLQGRGDNDIS 286 small-eared galago
BAC11386     177 LNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHR---IQHNIdylKHLSKVKKIPSDFEGSGYTDLQERGDNDIS 253 human
Q8K4L6       190 PFS 192 house mouse
XP_003414137 282 PFS 284 African savanna elephant
XP_019817681 251 PFS 253 zebu cattle
XP_003985237 285 PFS 287 domestic cat
XP_004756164 285 PFS 287 domestic ferret
XP_023493519 278 PFS 280 horse
ELK13678     159 PFS 161 black flying fox
ELW70200     263 PFS 265 Chinese tree shrew
EGW12409     177 PFS 179 Chinese hamster
ACS37551     176 PFS 178 Norway rat
XP_003790071 287 SFS 289 small-eared galago
BAC11386     254 PFR 256 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap