5ZXA


Conserved Protein Domain Family
FAP

?
pfam07174: FAP 
Click on image for an interactive view with Cn3D
Fibronectin-attachment protein (FAP)
This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix.
Statistics
?
PSSM-Id: 399866
View PSSM: pfam07174
Aligned: 8 rows
Threshold Bit Score: 282.562
Threshold Setting Gi: 500104275
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZXA_A            1 MHQVDPNLTRRKGRLAALAIAAMASASL---VTVAVP-ATANADp--ePAPPVPTTAASPPStaaa--------ppaPAT 66  Mycobacteriu...
P46842            1 MNQVDLDSTHRKGLWAILAIAVVASASA---FTMPLP-AAANAD----PAPLPPSTATAAPS---------------PAQ 57  Mycobacteriu...
VBC:MMAR_2737     1 MHEVDPNKRRRHGLWTTLALAAVSSASV---VSIALP-ATASADp--aPAP-APSTTAAPPAdpna--------appPAD 65  Mycobacteriu...
AAS03886          1 MDQVEATSTRRKGLWTTLAITTVSGASA---VAIALP-ATSHADpe-vPTPVPPSTATAPPAapapngqpapnaqpaPGA 75  Mycobacteriu...
WP_023985848      1 MDQSDVNSSHRRRRTAGLLAAAAAGATA---AALTLPvAVSHAEp--vPAPPPPVPAEPAPApgtp--------apaPGA 67  Mycobacteria...
tigr:MSMEG_3618   1 MYESDSMSHRRSGLSKKLTLAAVTGMTA---VAVALP-SVAHAD----PEPPPPPP-GNTFLpapp--------padPNA 63  Mycolicibact...
WP_011780282      1 MDQPDMHAKRRKGLPTSFRRSALTGATAaltAVFTLP-AVAYAQpappPSPAPPPAVEAPPVppp---------pvdPNA 70  Mycolicibact...
WP_014213068      1 MDQQDAVRVHRKGLSKSLAIAALTGATA---VALALP-SIAQAQpaptPAPPPPPPSGNTFLqgp---------pppPGA 67  Mycolicibact...
5ZXA_A           67 PV----APPPP-------------------AAANTPNAQP----GDPNAa-pPPADPNAPPP-PVIAPNApqpVRIDNPV 117 Mycobacteriu...
P46842           58 EI----ITPLP-------------------GAPVSSEAQP----GDPNA---PSLDPNAPYP-LAVDPNA---GRITNAV 103 Mycobacteriu...
VBC:MMAR_2737    66 PNa---PPPPP-------------------ADPNAPPPPP----ADPNApppPPADPNAPPP-PVVDPNApepGRVNNAV 118 Mycobacteriu...
AAS03886         76 PApngqPAPAA-------------------PAPNDPNAAPppvgAPPNGappPPVDPNAPPP-PPADPNA---GRIPNAV 132 Mycobacteriu...
WP_023985848     68 PA----PTPLP------------------------PGVPPp--pADPNA---PPVDPNA----PP--PPApepGRVDNAA 108 Mycobacteria...
tigr:MSMEG_3618  64 PA----PAPAPapapapapapalapapapgAPAPAPAPAPa--pADPNApapAPADPNAPAPaPAEEPPApepGRVDNAA 137 Mycolicibact...
WP_011780282     71 PV-----PPPP-------------------VDPNAPVPPPp--pVDPNApvpPPADPNAPVP-PA--Pe---pGRIDNAA 118 Mycolicibact...
WP_014213068     68 PA----PPPPP-------------------ADPNAP-PPPp--pADPNApppPPADPNAP---PA--PPPveaGRVDNAA 116 Mycolicibact...
5ZXA_A          118 GGFSFALPAGWVESDAAHFDYGSALLSKTTGDPPFP----GQPPPVCNDTRIVLGRLDQKLYASAEATDSKAAARLGSDM 193 Mycobacteriu...
P46842          104 GGFSFVLPAGWVESEASHLDYGSVLLSKAIEQPPVL----GQPTVVATDTRIVLGRLDQKLYASAEADNIKAAVRLGSDM 179 Mycobacteriu...
VBC:MMAR_2737   119 GGFSFVVPAGWVESDASHLDYGSALLSKMTGEPPMP----GQAPPIANDTRVVLGRLDQKLYASAEATNPKAAVRLGSDM 194 Mycobacteriu...
AAS03886        133 GGFSYVLPAGWVESDASHLDYGSALLSKVTGPPPMP----DQPPPVANDTRIVMGRLDQKLYASAEANNAKAAVRLGSDM 208 Mycobacteriu...
WP_023985848    109 GGFSYVVPEGWRVADATQLSYGQALLTKI---PPAG----TEQP--ANDTSVLLGRLDLKLFAGSEADNAKAATRLASDM 179 Mycobacteria...
tigr:MSMEG_3618 138 GGFSYVVPEGWQVSDATQLSYGQALLTKT---VAEG----AEPP---NDTSVLLGRLDLKLFAGAEPDNNKAAVRLASDM 207 Mycolicibact...
WP_011780282    119 GGFSYVVPAGWEVSDSTQLSYGQALLTKL---PPEGappdAQPP---NDTSVLLGRLDLKLFAGAENDNTKAAQRLASDM 192 Mycolicibact...
WP_014213068    117 GGLSFVVPAGWKVSDSTQLSYGQALLTKI---APEG----AEPP---NDTSVLLGRLDLKLFAGAETDNTKAAQRLASDM 186 Mycolicibact...
5ZXA_A          194 GEFYMPYPGTRINQETVSLD-ANGVSGSASYYEVKFSDPSKPNGQIWTGVIGSPAANAPDAG--PPQRWFVVWLGTANNP 270 Mycobacteriu...
P46842          180 GEFYLPYPGTRINQETIPLH-ANGIAGSASYYEVKFSDPNKPIGQICTSVVGSPAASTPDVG--PSQRWFVVWLGTSNNP 256 Mycobacteriu...
VBC:MMAR_2737   195 GEFFMPYPGTRINQETIPLN-ANGITGSASYYEVKFSDESKPNGQIWTGVVGTPAGSTPNEG--PPQRWFVVWLGTSNDP 271 Mycobacteriu...
AAS03886        209 GEFFMPYPGTRINQDSTPLNgANGSTGSASYYEVKFSDASKPNGQIWTGVIGS-----ANGG--NAQRWFVVWLGTSNDP 281 Mycobacteriu...
WP_023985848    180 GEFFMPFPGTRLGQESAPLT-AGDLTGSASYYEVKFTDTNKPNGQIWSGVVGTPVAAGT-RGqrAPERWFVVWLGTANNP 257 Mycobacteria...
tigr:MSMEG_3618 208 GEFFMPFPGTRVNQQTVQLN-ADGMPGVASYYEVKFTDANKPAGQIWAGVVGQPVAPGTPRGqrTPERWFVVWLGTANNP 286 Mycolicibact...
WP_011780282    193 GEFFMPFPGTRVNQQVVPLD-N---NGVASYYEVKFTDTNKPNGQIWAGVVGEPVAPGTPRGqrTPERWFVVWLGTATNP 268 Mycolicibact...
WP_014213068    187 GEFFMPFPGTRINQKTVPLD-AAGMPGVASYYEVKFTDANKPTGQIWAGVVGEPVEPGTPRGqrTPQRWFVVWLGTATNP 265 Mycolicibact...
5ZXA_A          271 VDKGAAKALAESIRPLVAPPPAPAPAPA 298 Mycobacterium tuberculosis H37Rv
P46842          257 VDKGAAKELAESIRSEMAPIPASVSAPA 284 Mycobacterium leprae TN
VBC:MMAR_2737   272 VDKGAAKVLAESIRPWM-PPPAPAPAPG 298 Mycobacterium marinum M
AAS03886        282 VDKVAAKALAESIQAWT-PPAAPPAAPG 308 Mycobacterium avium subsp. paratuberculosis K-10
WP_023985848    258 VDKAAAVNLAQSIRPWSPPPPPPPPDPN 285 Mycobacteriaceae
tigr:MSMEG_3618 287 IDKDAAVALANSIRPWAPPPPPPPAPAD 314 Mycolicibacterium smegmatis MC2 155
WP_011780282    269 IPQAEAVTLANSIRPWTPPPPPPPADPN 296 Mycolicibacterium vanbaalenii
WP_014213068    266 IPQEEAVTLANSIRPYTAPAAPPPADPN 293 Mycolicibacterium rhodesiae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap