Conserved Protein Domain Family
DUF1397

?
pfam07165: DUF1397 
Protein of unknown function (DUF1397)
This family consists of several insect specific proteins. A member from Manduca sexta is annotated as being a haemolymph glycoprotein precursor. The function of this family is unknown.
Statistics
?
PSSM-Id: 399860
View PSSM: pfam07165
Aligned: 39 rows
Threshold Bit Score: 186.33
Threshold Setting Gi: 118784846
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002021994  58 SLADLQRLLRAKCEKANQalpagsvnATALGTAIEQAA-GQLMGCIGGLANVTEILDEIEKAsPKGDLDVVFEKYCLRLP 136 Drosophila pers...
Q17F99        33 EGQEVIESLERQCLQLTG--------STETFEKLVAGF-SFAPMCFAGHLDLEGLAADIIEL-NDSNRAKFFGTYCPQMN 102 yellow fever mo...
EDS34182      37 ELAEFLGEVESSCRKLTG--------SNETYEMMVLNA-ALVPLCVISKLDIESFSTDLDNL-DETNRTEFFPKYCPQLH 106 southern house ...
Q17FA1        42 DLKEYLVQIQTMCYEKTN--------SSEAFDALLTSM-YGVPDCIQGMVDLPSFMQDFADL-SASTRNKMFPKYCSQIR 111 yellow fever mo...
ETN57888      33 ESNESLEDIREQCIENTG--------SDADFPKFMASV-EQAMLCLAG-FDSKNFINDIRHL-SNATRATFFPKYCPKIR 101 Anopheles darlingi
ETN62935      48 DSTDMETKLREQCIENTG--------SYLTYEIFRKSL-DKFYSCAPMHLG-SRFEEDFILL-TNATRETFFSEYCPRVR 116 Anopheles darlingi
ETN67659      48 nVGKMLQEIRAQCIKNTG--------SDADFPKFMASV-ELAVVCLAD-FDTEKLKIDFNEL-TNATRATFFPKYCDKLR 116 Anopheles darlingi
ETN61236      35 EVDEFLTEMREMCKNNTG--------SDEAFPNFMQSV-EQAMMCATA-FDVDNFVSDLEKL-TNATRGTFFPNYCPKLR 103 Anopheles darlingi
Q7Q5Q0        37 ETGEIMKELQELCRNNSG--------SDAAFVTLMESA-QTTFTCFVGAIDLDAFMSDLYTL-SNETRSTFFPRYCPQLR 106 Anopheles gambi...
XP_001844456  30 ERMEFMQEIKDECRNNTG--------DDRAFQDLLVVLnQDTPKCFMQHVNLSYLQAPITNF-NKQEQTTLMTQICGQVE 100 southern house ...
XP_002021994 137 QAKTCLREFNAVLQPCL-TREERSHNALMQRIMDKLLEFVCYKNGDQIALFIAEQGPECLQASRDHIATCLNTTFAGYLP 215 Drosophila pers...
Q17F99       103 ESLQCINPLFELLRTCW-DGEELAIMDIMYNMIPEALNLMCKDHGEIFFRLEGPEYNKCVEKFDDYTAECSGKI-SNSTE 180 yellow fever mo...
EDS34182     107 DSLSCLEPVTAELRKCL-DPEEVEVLDVIVNMLPEGLNLACKDNGQIFF-MDDSDFNECSDKFVGYVEKCADKI-SNTTD 183 southern house ...
Q17FA1       112 SALVCLDPPKEEFRKCL-DANDAVILDGVVNAMPEAIDLICRNNGEILYK-DNANYHVCMSKYSSYAAECAGMV-SNETD 188 yellow fever mo...
ETN57888     102 SLVSCIDGSLLGMQPCL-DEDVFKIAEALIESIPDAVDLACKNDGEIFLKLEDEERQECIMENTVQLSECVETLSINFDN 180 Anopheles darlingi
ETN62935     117 PIVSCLEESLMGMQPCL-KQGTLQIVAAFVRSISEAVALACKNDGEIMFQLKNEKHQTCMNDKADDI---AHAIFTLTMS 192 Anopheles darlingi
ETN67659     117 SFGSCINISLIYMQPCL-KSSAFQIAKALIDSIPEASNLACKNDGEIIFQLKDEERKECIMQKEDEISACFNTFKTDMNG 195 Anopheles darlingi
ETN61236     104 TVATCKDGILAGMKPCL-ESDDYNIVDALAGIIPDAVELICKNDGSIIFQMEDETRLECIGSKVDELTVCATSVASTWND 182 Anopheles darlingi
Q7Q5Q0       107 TAYKCTDQLLNDFRPCL-EEDDFTIVQALSGIIPDAVDLMCKNEGEILFKLEEPKYADCVAKIGDNFNECINTF-LNGTD 184 Anopheles gambi...
XP_001844456 101 KSLTCINPVVDKVKRCMtDDDDLKILRKLADTVPEALKMICNDSGAMLLKLREPLARSCAIELAPTIDVCMDGM-SNSTM 179 southern house ...
XP_002021994 216 QVGQLsssniadllpelVLGPRQCVDLYDFETCTVRHLERCETITPSNIVESMFRYVRKESNC 278 Drosophila persimilis
Q17F99       181 TMYLS------------KLDEGQCRELGDFRGCIAEKLQICKAPGIIDLIDIFYKPMVKASSC 231 yellow fever mosquito
EDS34182     184 AMNLS------------SYGPKQCDELSQVRECFEQQMVECKAPKLIEIFDLFYRPMVKASPC 234 southern house mosquito
Q17FA1       189 FMEIS------------KFGPSQCDELTNVRNCMGGKFDECNGPQVMEVFDIFWRALIKGTPC 239 yellow fever mosquito
ETN57888     181 AIELF------------ELTQGQCRELVIFRECMKEQLDPCDLSDIVSIYDIPMNAILPLTPC 231 Anopheles darlingi
ETN62935     193 LKDVS------------ELREDHCRELNYARQSIKFLLGACELSDILKVLDVPINAMFGVMPC 243 Anopheles darlingi
ETN67659     196 IIDFA------------ELKQDQCGPLANFRECLKDILDHCDLSDIVSVYDIPLNTILPLAPC 246 Anopheles darlingi
ETN61236     183 DSDLS------------ELTPDQCSALISFRQCIKEKLDACQVSEILGIYDLFHNALFRMTPC 233 Anopheles darlingi
Q7Q5Q0       185 DWDIS------------HLNQDQCNTLTGFRQCVESKLSICKAPELISVYDLFHNTLFRMTPC 235 Anopheles gambiae str. PEST
XP_001844456 180 EMALS------------RYTITECNEVYNMRDCIINRIRDCGANTYLELFNLFYRSLLSLTPC 230 southern house mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap