Conserved Protein Domain Family
DUF1391

?
pfam07151: DUF1391 
Protein of unknown function (DUF1391)
This family consists of several Enterobacterial proteins of around 50 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi where they are often known as YdfA. The function of this family is unknown.
Statistics
?
PSSM-Id: 369233
View PSSM: pfam07151
Aligned: 2 rows
Threshold Bit Score: 99.0838
Threshold Setting Gi: 82583756
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P0ACW0  2 QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT 49  Escherichia coli K-12
P0ACW0  2 QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT 49  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap