Conserved Protein Domain Family
MalM

?
pfam07148: MalM 
Maltose operon periplasmic protein precursor (MalM)
This family consists of several maltose operon periplasmic protein precursor (MalM) sequences. The function of this family is unknown.
Statistics
?
PSSM-Id: 399849
View PSSM: pfam07148
Aligned: 24 rows
Threshold Bit Score: 135.843
Threshold Setting Gi: 81541228
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7N988        83 EIQGPIAAFALPANRGSLDITLSSLVq-DK----QVYVPNVLVLDQGLRPAAFYPSSYFPYERPGVMSTDRLEGTL---K 154 Photorhabdus la...
WP_014257902  66 QISSPVAVFEVPANRGQMSLTITSDI--KD----SVFYPHVMITDRNGAVIENYDDSVFEYRKPRLNLGNRLVAEL---D 136 Vibrio furnissii
WP_012019254  87 SGKSFFRAFQLPAASKSFEIRLYSQA--GD----TVLAPNAMLLDSQFRVTRLLGADDFVYAPASGLKGDSLDARLrvdR 160 Pseudomonas men...
WP_011768973  85 TGKSFVKGIALPVVDGTIKMTLSSPIa------aGVFVPTLLILDEQHKALQRYSEETIKYDSASLLKADRLFADIe-fP 157 Psychromonas in...
WP_013333437  83 TGPSPFHAMELPRGMGPLRLELISRVrrDDqghlSLFAPLVLILDETGAIQRRFDWRKFTYQPARGLNDDRLHLSF---G 159 Halomonas elongata
Q6LK93        70 EGKSYFVGFVIPQNVERMSVDLKSWMk-TA----GVFAPKVLLLDPQFQPVKMITLDEFEVKPSNIFSLSSYQHRF---- 140 Photobacterium ...
Q5E2I0        72 DGNSYFNAFKFAERSGKVQLRLSSLMi-ND----SVAAPKLIALDHEFNVVSTTSLDQFDVKPSDAFTRTQFQLNF---- 142 Aliivibrio fisc...
Q7MGB5        75 QGNSHFAAFRFSERSGDVTVTVSSLMi-DD----SVFAPEVLLLDNQFKVVETFKLADFQILPSDAFTRTRYIERF---- 145 Vibrio vulnific...
CAV25459      71 TGNSHFAAFKFSERSGEMVVKLSSLMi-DD----SVFAPEAMLLDENFKPVQTLKFEDFKVQASDAFTRTSYIERL---- 141 Vibrio tasmanie...
Q9I2X4       265 MGRSFYAAIRLPRSQGVYGLRIRSFAn------rQVVYPSLLFLDEHKRPTRLVSDAVYKLNPETWYRYAFIEGTV---- 334 Pseudomonas aer...
Q7N988       155 LTPALGQQ-QIYVLVYTTRTDLQKSTQMVDPAKAYAQGVGN-AVPAIPDPVARHTQTGTLKLKV 216 Photorhabdus laumondii subsp. l...
WP_014257902 137 FYPPQGYK-NLYVVVYTKEADLQDVTYVAHPGRVDAEARGN-YMPELKDIAVPRSLTGTVELDV 198 Vibrio furnissii
WP_012019254 161 LYPDNPGN-EHYLVLYTSEAQMRGRTVIEHPAKAFARALGN-EAPNIPDPVAKHAPVGVIKMvl 222 Pseudomonas mendocina
WP_011768973 158 AVFADGRR-AKYLLVLTTEEAMQSTTKLA-PQKQLAAEVGR-ADLFYKTQPIAHTATGVVRLTF 218 Psychromonas ingrahamii
WP_013333437 160 ITPSARAD-R--LVVLTSDAARAAESELLHPARAQARARHL-AEPAVVDPVAPHLASGEVSLRV 219 Halomonas elongata
Q6LK93       141 --VMEQSK-TPYMVVYSPQEYREGSIQIPHPERLRAEELGL-ARPMVTDPVIQHQKFGSLEIDL 200 Photobacterium profundum
Q5E2I0       143 --QLNAAK-TPYFIIYSSNEYLGQSIKVKHPARIRAEELGE-PMPMVTDPTYAYERFGKLKLSI 202 Aliivibrio fischeri ES114
Q7MGB5       146 --TTNAEQ-TPYFVIYTPADQLGKQVTVDHPAKVRAKEFGE-VMPMVTDPVYTHRLGGRVEVQV 205 Vibrio vulnificus YJ016
CAV25459     142 --RIDASK-TPYIVIYTPADELGNKVKVDHPAKVRAKEFGE-VMPMVTDPVYTNQLGGRLELEI 201 Vibrio tasmaniensis LGP32
Q9I2X4       335 --PVRANRgERYVLLLTTDEDRSLQTL---DNKPFKRPLQDlAVNEAGMQVHEHARQGGFELAV 393 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap