Conserved Protein Domain Family
DUF1387

?
pfam07139: DUF1387 
Protein of unknown function (DUF1387)
This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals.
Statistics
?
PSSM-Id: 399844
View PSSM: pfam07139
Aligned: 19 rows
Threshold Bit Score: 300.878
Threshold Setting Gi: 156406474
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008112610  94 WTVTGKKKNKKKKTKPKPSAESSASLHDPSKPVSTEEEQSVasseKGGINGYHVNGLT-NDTESVDSLSEGLDTLSIDAR 172 green anole
Q86XZ4        81 WTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQSApsseKGGMNGYHVNGAI-NDTESVDSLSEGLETLSIDAR 159 human
XP_002123251  53 WRPAGPMKNKKKKKKKQQKK-----------------------------NKLDVETQLnLDTTTFDP--KVDDITKPDKV 101 vase tunicate
XP_008111980  59 WNMTGKKKNSKRKRSKSKQHYLSKDAKDKDERAEKTSLES------QELNGCHLNDCD-KE-TFFKPVGEKSTMIPQEEK 130 green anole
XP_005049257  59 WNMTGKKKNNRRKRSKSKQHQGNKDPKNKNSGPEKASQEP------QQINDCHMNGCP-KDSSGRGSANQKLETSSLENK 131 Collared flycat...
XP_002188589  59 WNMTGKKKNNRRKRSKSKQHQGNKDSKNKNSGPEKASQEP------QRINDCHMNGCP-KDNSGRGSANQKLETTSLEKK 131 zebra finch
XP_007494646  59 WNMTGKKKNNKRKRSKSKQHQGNKDAKDKVDKAEAASLVP------PGMYNCHVNGCD-KDNSSTESTHDKTERLPREKK 131 gray short-tail...
Q5U2T3        59 WSMTGKKKNNKRKRSKSKQHQGNKDAKDKGERPEVGPLQPQ----APLVQNGHMNGCE-KDSSSPDSAREKLALTPREKK 133 Norway rat
XP_005989586  60 WNLTGKKKNYKRKRNKAKHKDMKETPDKSEDQ--------E----ARGIKSYQVNGCD-VNISLVEPLSGRLETISIEEK 126 coelacanth
XP_028929467  50 wtvtgkkkNKKKKSKPKPAPE-------PSKPAPTPEEQPGvpseRGGLNGYHVNGSA-NDTESVDSFGEGLDVPSTGIR 121 platypus
XP_008112610 173 ELEESEPTMPEVSHGA-------------------------VTLeLENGIMDFSPRSATM-RSSQNAQSPrvq--pelKN 224 green anole
Q86XZ4       160 ELEDPESAMLDTLDRT-------------------------GSM-LQNGVSDFETKSLTM-HSIHNSQQP--------RN 204 human
XP_002123251 102 EPTTDQSRAAET-----------------------------LKLlLTDAEPNPEPQLTLQ-ANSKPPQPPinnpttpqPT 151 vase tunicate
XP_008111980 131 TSEYKERRETKPENSD-------------------------KKMeQKKVSLDAEQKYINS-AEVPDTSQSsyq---spCN 181 green anole
XP_005049257 132 GSGFVGSAQDCPESKDtthhqlnkvihkkhlqnegssihqnREReRQRVSVELNPKTVNG-VEQHEPLQSsvq---lqCN 207 Collared flycat...
XP_002188589 132 SSTF----VGSALDCPei---------------------rdREReRQRVSVESNPKTVNG-VEQHEPLQSpvq---lqCN 182 zebra finch
XP_007494646 132 PLALEEPLQAQPEVTEg------------------------SRLpRQRLSLDANPKPVPG-IERSDGLQAsaq--pqyCN 184 gray short-tail...
Q5U2T3       134 ISILEEPPRAQRGITEg------------------------SRLlQQKMSLDGNPKAIHGpSERSDGLQWsag---qpCN 186 Norway rat
XP_005989586 127 SPVTEEKQEQSNSEIRv-----------------------nHSLqCDRLVVETGHQLVQD-SGAPELSKPaae---qqHN 179 coelacanth
XP_028929467 122 DSEDTEPAAAGGSDGS-------------------------GSr-LANGISDFDPKCLAL-PQGQASHRAlrp---esRN 171 platypus
XP_008112610 225 PGKS----------FSRPVSSNQSPAPSsm-tiLDEVPVSSGn---------KKLGSNIEKSVKDLQRCTVSLARYRVVV 284 green anole
Q86XZ4       205 AAKS----------LSRPTTETQFSNMG-----MEDVPLATS----------KKLSSNIEKSVKDLQRCTVSLARYRVVV 259 human
XP_002123251 152 EGKPhlthlykaghRSRTSSESSVKRSSkklvkSNLVQESTTngsvqetatfNQNKKSIEKATKDLQRCSASFGRYRSLL 231 vase tunicate
XP_008111980 182 ISRP----------KFRTSTAKSPVSVPqveikPEESI--------------KKRGPNIEKSVKDLQRCTVSLTRYRMMI 237 green anole
XP_005049257 208 LGRP----------KSKSSSVKSPNASTqpetkTDDSV--------------KKRGPNIEKSVKDLQRCTVSLTRYRVMI 263 Collared flycat...
XP_002188589 183 LGRP----------KS--SSVKSPNVSTqletkTDDSV--------------KKRGPNIEKSVKDLQRCTVSLTRYRVMI 236 zebra finch
XP_007494646 185 TSRP----------KSKPSVVKSCTPAThpevaADEVL--------------KKRGPNIEKSVKDLQRCTVSLTRYRVMI 240 gray short-tail...
Q5U2T3       187 PSKP----------KAKTSPVKSNAPAAhleikPDELA--------------KKRGPNIEKSVKDLQRCTVSLTRYRVMI 242 Norway rat
XP_005989586 180 PGRP----------KTRNPVAKTHGPTDqtevmPEDLR--------------KK-GPNIEKSVKDLQRCTVSLTRYRMMI 234 coelacanth
XP_028929467 172 AGRP----------LSRAAPASQLSALGpf-alLEDAPLSSAn---------KKLGSNIEKSVKDLQRCTVSLARYRVVV 231 platypus
XP_008112610 285 KEEMDASIKKMKQAFAELQSCLMDREVALLGEMDKVKAEAMEILSSRQKKAEALKKLTDVAVRMSEEQLVELRADIKHFV 364 green anole
Q86XZ4       260 KEEMDASIKKMKQAFAELESCLMDREVALLAEMDKVKAEAMEILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFV 339 human
XP_002123251 232 NDEINDSYKRIKQTFEEANNALQDREVELMRSLDKLKEEAFKLLEAREHRALELKRQTDRVANMKPHQVAELRGEIKHFV 311 vase tunicate
XP_008111980 238 KEEVDNSVKKIKAAFAELHNCIIDKEVALMAEVDKVKEEAMEILTARQKKAEELKRLTDLASQMAETQLAELRAEIKHFV 317 green anole
XP_005049257 264 KEEVDNSVKKIKAAFAELHSCIVDKEVSLMAEIDKVKEEAMEILTARQKKAEELKRLADLASQMAEAQLSELRAEIKHFV 343 Collared flycat...
XP_002188589 237 KEEVDNSVKKIKAVFAELHSCIVDKEVSLMAEIDKVKEEAMEILTARQKKAEELKRLADLASQMAEAQLSELRAEIKHFV 316 zebra finch
XP_007494646 241 KEEVDNSVKKIKAAFAELHSCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLTDLSSQMAEAQLAELRAEIKHFV 320 gray short-tail...
Q5U2T3       243 KEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFV 322 Norway rat
XP_005989586 235 KDEMDASVKRIKANFAELQSCIIDREVALMAEMDKVKEEAMEILNARQRKAEELRRLADLAIQMSEEQLSQLRAEIKLFV 314 coelacanth
XP_028929467 232 KEEMDASIKKMKQAFADLQCCLMDREVALLAEMDKVKAEAMEILLSRQKKAETLKKMTDVAVRMSEDQLVELRADIKHFV 311 platypus
XP_008112610 365 SERKYDEDLGRVARFTCDLDALKRSIDSFGQVSHPKNSYSTRSRCS 410 green anole
Q86XZ4       340 SERKYDEDLGRVARFTCDVETLKKSIDSFGQVSHPKNSYSTRSRCS 385 human
XP_002123251 312 SDRKYDEEIGRTTRFIFNREIITDVIPALGEISGVKNSYSHKSRpr 357 vase tunicate
XP_008111980 318 SERKYDEELGRSARFSCDIEQLKTQILQCGEISHPKNNYSSRTP-S 362 green anole
XP_005049257 344 SERKYDEELGRSARFSCDTEQLKTQIQLCGEISHPKNNYSSRTPCS 389 Collared flycatcher
XP_002188589 317 SERKYDEELGRSARFSCDTEQLKTQIQLCGEISHPKNSYSSRTPCS 362 zebra finch
XP_007494646 321 SERKYDEELGRSAKFSCDIEQLKTQIMLCGEISHPKNNYSSRTPCS 366 gray short-tailed opossum
Q5U2T3       323 SERKYDEELGKAARFSCDIEQLKAQILICGEITHPKNNYSSRTPCS 368 Norway rat
XP_005989586 315 SERKYDEELGRSARFSCDGEQLKTQIQSFGEVSHPKNNYSIRIPCn 360 coelacanth
XP_028929467 312 SERKYDEDLGRVARFTCDVDALKKSIDSFGQVSHPKNSYSTRSRCn 357 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap