Conserved Protein Domain Family
DUF1386

?
pfam07138: DUF1386 
Protein of unknown function (DUF1386)
This family consists of several hypothetical Nucleopolyhedrovirus proteins of around 350 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369226
View PSSM: pfam07138
Aligned: 2 rows
Threshold Bit Score: 705.261
Threshold Setting Gi: 23476507
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN28054   1 MSLAAKLIVYNYYAKYNEVHDVYGESYHHYRIVQEYLSESYVNGMSCIERDVTAMRRLKSGSCTFDEAVKMIDACDSIKS 80  Rachiplusia ou MNPV
AAC33761   1 MSLAAKLIVYNYYAKYNEVHDVYGESYHHYRIVQEYLSESYVNGMSCIERDVTAMRRLKSGSCTFDEAVKMIDACDSIKS 80  Rachiplusia ou MNPV
AAN28054  81 LSHWFSTSEMMGINDNVREVLEQIDAVVPVSVRVQNGWQIFSLNNFEREISQDMLDCLQIILGRFEYFMRNGKLLRLSTV 160 Rachiplusia ou MNPV
AAC33761  81 LSHWFSTSEMMGINDNVREVLEQIDAVVPVSVRVQNGWQIFSLNNFEREISQDMLDCLQIILGRFEYFMRNGKLLRLSTV 160 Rachiplusia ou MNPV
AAN28054 161 FNPNNNVVGWWYNKFCVVTYVHRIMYQSVPAELAPRLSEAVKKFIRLRKSDYDDRLHLDESYNCPRVIAEIYGRFCGIGK 240 Rachiplusia ou MNPV
AAC33761 161 FNPNNNVVGWWYNKFCVVTYVHRIMYQSVPAELAPRLSEAVKKFIRLRKSDYDDRLHLDESYNCPRVIAEIYGRFCGIGK 240 Rachiplusia ou MNPV
AAN28054 241 EHFSKHKLSCMHILFQYLRGKTTQEEESFPCYRVIKDFGRQCKDVYKNLKDVFDVLHAHSMSDKDKNSLMDLLCVMDCEE 320 Rachiplusia ou MNPV
AAC33761 241 EHFSKHKLSCMHILFQYLRGKTTQEEESFPCYRVIKDFGRQCKDVYKNLKDVFDVLHAHSMSDKDKNSLMDLLCVMDCEE 320 Rachiplusia ou MNPV
AAN28054 321 IDVDCFYYIFEAFL 334 Rachiplusia ou MNPV
AAC33761 321 IDVDCFYYIFEAFL 334 Rachiplusia ou MNPV
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap