Conserved Protein Domain Family
ZapC

?
pfam07126: ZapC 
Cell-division protein ZapC
ZapC is one of four FtsZ-binding components of the Z ring in bacteria. Formation of the Z ring on the cytoplasmic surface of the membrane is the starting process for assembly of the cell-division apparatus. It binds directly to the Z ring, and although it is not essential for absolute cell division it contributes to it by enhancing the interactions between the FtsZ protofilaments (or polymers) which aggregate to form the ring conformation in the Z ring.
Statistics
?
PSSM-Id: 399838
View PSSM: pfam07126
Aligned: 34 rows
Threshold Bit Score: 192.797
Threshold Setting Gi: 469771145
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D457              2 KLKPDDNWRWYFDTEHDRLMLDLANGMLFRSRFPSKMLTPDAFNECAFCVDDAALFFTYNDKC-QK-AALHRD-LQGELV 78  Pectobacte...
Q3IGZ2              1 MLQASKQWQWISCAKKNRLLLDLNEDMQLCTPYKLRQLTDSTFKNPYFSLEDAAFYEQVYQYL-VQ-FKLWNPaQLCQIS 78  Pseudoalte...
C4LEY8              2 ILLPDENWRWVFDEQRQSLLLDLSDDMQFVVSVPPKQLAQKQAFTEHFSLDDSSLYFHFLECL-GE-FPFTDP-ERVQIV 78  Tolumonas ...
A0KKK8              2 CIQPNDNWQWHYDAHDDRLMLDLSDRMIFATEYKGRQLVPSSFTTQPFCVDDAALYYQLMDRV-AE-LEWSVP-HQVQLV 78  Aeromonas ...
Q12NG1              2 LLMPTKDWRWEFNEEYGQLALSLDTQMSFLTAYKTKMLIPDALKGMKFSVEHAKFYIRMLERLpQL-LTLSDA-MIVQTA 79  Shewanella...
Q081K0              2 LLMPNKDWHWEYNETCKQLSISLGSEMEFLTPYKTKLLIPDALTATEFNLEHAKFYIKMLETLpKV-LHISDA-GIVQTA 79  Shewanella...
BAJ01830            2 LLMPKRDWQWKYNDAYSVLSISLGSEMEFLTPYKMKMLIPDALMELDFSVEHAKFYIEFLELLtNL-SCIADA-FKVQLA 79  Shewanella...
WP_011865609        2 LLMPQRDWQWIYNDSYGVLSVSLGSDMEFLTPYKTKALIPDALATTEFNVEHAKFYIEFIERIgKS-LNIADA-VRVQLA 79  Shewanella...
Q15UB6              1 MLLPNTNWFWY--THENELRLDLGDTLTFVAPFALKNLVNLPSDKQLFSLEDTEHYVALAESLdNSgLELSDG-ELVQIL 77  Pseudoalte...
UNSW:PCNPT3_07440   2 IYLPQADWQWSIDPQDNSVSVLMGDDSVELV-YQARMFISLPQKILSFSLEDVAHYTLLKEQFcAE--QYTAD-QSCSII 77  Psychromon...
Q6D457             79 LNALVATRFLKPLMPKSWHFIQQPDAmtySPQAGDVVQvqLTETHETACFLVAEAGDKACLCLLAQEQLSLSG-KTMLLG 157 Pectobacte...
Q3IGZ2             79 LNATAVKFQLKPVLAKSWFFEQYTGS---TPSTEAVIN--LTSKAQSGEFLIVEHSSDASVCINLSENFQLDDnLSLVQF 153 Pseudoalte...
C4LEY8             79 LNAVAAVKYTRPLVSQSWYYRDVDMLs-gEPELGEVFS--VVTEFTYGDVMIISPGSNASLCIVISQAIQLDAdKSLRQS 155 Tolumonas ...
A0KKK8             79 LNAIAVSRFYKPLMPQSWFFGETHPAi--IPETGALVC--MGTPHGKGEFLVIEAGEQASVCLNLTDDLILTTsKTLPRF 154 Aeromonas ...
Q12NG1             80 LNATAAHFLLKPQMPKSWFFDVSDECv--YFDLGKVFQ--LKNNQQSMLVLVVEVGLQSVLVMNLSAACQLSDnKSLGQF 155 Shewanella...
Q081K0             80 LNATAAHFLLQSQMPKSWFFDVSDECv--YCEVGKLFQ--LNCGYSKVLALVVDNGLQAATVMILSQYCQLSDsKSLVQF 155 Shewanella...
BAJ01830           80 LNATAAHFLLKPQMPKSWFFATSSMCv--FSELGKIFK--LSCREVNAQVLVVETSVQASLVMLLDEKLQLSDsKSLAQF 155 Shewanella...
WP_011865609       80 LNATAAHFLLKPQMPKSWFFETSAVCv--YSELGKVFQ--LKCQGEVVQVLVVESNIQASLVMLLSPELHLSDsKAMRQF 155 Shewanella...
Q15UB6             78 LNATAALKFHKPIGMKSWLYKTQSTSg--VHYQLALLEptDTAYPELGQVIVIEQDGACATCMLISNEFAVNSsKKFSKF 155 Pseudoalte...
UNSW:PCNPT3_07440  78 LHILAVTLFHKPIMPKSWQYQTCAIEa-lDIRSRECVYltSDQEKVTAKYFVIDVDDKFALCLLVDTQHILTSrKTLRQG 156 Psychromon...
Q6D457            158 DAIKIMHDRLILAVVQ 173 Pectobacterium atrosepticum
Q3IGZ2            154 EAIRVLNNRVHPLLNQ 169 Pseudoalteromonas haloplanktis TAC125
C4LEY8            156 SVCKLMNSKLLPYQAA 171 Tolumonas auensis DSM 9187
A0KKK8            155 GVIKVMNNRMSPRPVA 170 Aeromonas hydrophila subsp. hydrophila ATCC 7966
Q12NG1            156 DTIKVMHDRLHPLSRA 171 Shewanella denitrificans OS217
Q081K0            156 DTIKVMHNRLHPLRKA 171 Shewanella frigidimarina NCIMB 400
BAJ01830          156 ECIKVMHDRLHPILVN 171 Shewanella violacea DSS12
WP_011865609      156 DCIKVMNDRLHPLKAN 171 Shewanella loihica
Q15UB6            156 EMIKVMNDRLIPCLVD 171 Pseudoalteromonas atlantica T6c
UNSW:PCNPT3_07440 157 QIVKVSLDKITLIDDG 172 Psychromonas sp. CNPT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap