Conserved Protein Domain Family
VLPT

?
pfam07122: VLPT 
Variable length PCR target protein (VLPT)
This family consists of a number of 29 residue repeats which seem to be specific to the Ehrlichia chaffeensis variable length PCR target (VLPT) protein. Ehrlichia chaffeensis is a tick-transmitted rickettsial agent and is responsible for human monocytic ehrlichiosis (HME). The function of this family is unknown.
Statistics
?
PSSM-Id: 284524
Aligned: 2 rows
Threshold Bit Score: 48.9759
Created: 14-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2GHT8 101 DLQQSSNSDLHESSFVELPGPSKEEVQFED 130 Ehrlichia chaffeensis str. Arkansas
Q2GHT8  41 DLQQSSNSDLHGSFSVELFDPFKEAVQLGN 70  Ehrlichia chaffeensis str. Arkansas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap