4QDJ


Conserved Protein Domain Family
Mg-por_mtran_C

?
pfam07109: Mg-por_mtran_C 
Click on image for an interactive view with Cn3D
Magnesium-protoporphyrin IX methyltransferase C-terminus
This family represents the C-terminus (approximately 100 residues) of bacterial and eukaryotic Magnesium-protoporphyrin IX methyltransferase (EC:2.1.1.11). This converts magnesium-protoporphyrin IX to magnesium-protoporphyrin IX methylester using S-adenosyl-L-methionine as a cofactor.
Statistics
?
PSSM-Id: 399829
View PSSM: pfam07109
Aligned: 67 rows
Threshold Bit Score: 119.528
Threshold Setting Gi: 122499819
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4QDJ_A                 133 CLDVLIHYPTEEASAMISHLASLADRRLILSFAPKTLGLTVLKKIGGLFPGPSKTTRAYQHKEADIRKILGD----NGFS 208 Synec...
WP_012333501           132 AMDSLIHYPAADILRALAVLARRTEASLLVTVAPRTALLTLMHAAGRLFPRGDRAPAIVPVSEAALRRRIAReaalDAFA 211 Methy...
PRJNA213647:NX02_18365 129 AMDSLIHYQRLDIVRAVTRLAAIARGSVVFTFAPQTPLLMAMLGVGRLFPRGDKSPAILPVRDRVLRSLIde--amPHAR 206 Sphin...
Q16DS3                 144 AMDSLIYYDETDIGRALAALEARTGGSIVFTVAPRTKALMAMWYAGKLFPRSDRSPVMIPHDAGRLARAALAq--gVSGQ 221 Roseo...
jgi:Dshi_3538          129 AMDSLIYYEAQDIGASLAKFCPRVRGSVIFTVAPRTPFLMTFWGVGKLFPRGDRSPTMIPHAPARLSKAAAEt--gARGA 206 Dinor...
WP_025311367           132 AMDSMIYYTADDLGQALANLCPRVRSSIVFTVAPRTPFLMAFWGVGKLFPRSDRSPTMIPHAPAKLARMASRh--gASGT 209 Rosei...
Q28W38                 132 AMDSMIYYTAPDLGRALAGLSERCPH-IVFTVAPRTPFLMAFFGLGKLFPRADRSPVMIPHAPKRISEKLLIn--qCDRT 208 Janna...
Q3J172                 129 AMDSLIYYTDADIAAALDRLGARTRHSVVFTVAPRTPFLMAFWTMGKLFPRSDRSPVMIPHPFQPLNEA-------TGGR 201 Rhodo...
rhodo:RCAP_rcc00661    131 AMDSLIYYRAPDIGRVLTELGKRTHSAIVFTVAPKTAFLMAFWWLGKLFPRSNRSPVMIPHALDKLQRH-------AGDS 203 Rhodo...
WP_013418672           131 AMDSLIHYKADDLVSALSGLAALADQKVLFTFAPRTLALSVMHSAGKLFPRSDRSPAIEPIAEAKLSGMIAKdsrlAGFA 210 Rhodo...
4QDJ_A                 209 IARTGMTSTRFYYSRILEAVR 229 Synechocystis sp. PCC 6803 substr. Kazusa
WP_012333501           212 VRRSRRITSGFYLSNALELAR 232 Methylobacterium sp. 4-46
PRJNA213647:NX02_18365 207 IGRDRRISASFYTSHALEVmt 227 Sphingomonas sanxanigenens DSM 19645 = NX02
Q16DS3                 222 VAPVERVTSGFYISQLMEVRv 242 Roseobacter denitrificans OCh 114
jgi:Dshi_3538          207 IREVERVTSGFYISTCLEYRa 227 Dinoroseobacter shibae DFL 12 = DSM 16493
WP_025311367           210 MTEVERVSRGFYISTCLEYAR 230 Roseibacterium elongatum
Q28W38                 209 LLKLEQVTSGFYISSCLEMRa 229 Jannaschia sp. CCS1
Q3J172                 202 LVKVGRVSRGFYISECLEFRP 222 Rhodobacter sphaeroides 2.4.1
rhodo:RCAP_rcc00661    204 LIKIDRVARGFYISECLEYRP 224 Rhodobacter capsulatus SB 1003
WP_013418672           211 QGRSERIVNGFYTSNAMELsa 231 Rhodomicrobium vannielii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap