6GGO


Conserved Protein Domain Family
PipA

?
pfam07108: PipA 
Click on image for an interactive view with Cn3D
PipA protein
This family consists of several Salmonella PipA (pathogenicity island-encoded protein A) and related phage sequences. PipA is thought to contribute to enteric but not to systemic salmonellosis. The family carries a highly conserved HEXXH sequence motif along with several highly conserved glutamic acid residues which might be indicative of the family being a metallo-peptidase.
Statistics
?
PSSM-Id: 369211
View PSSM: pfam07108
Aligned: 3 rows
Threshold Bit Score: 432.552
Threshold Setting Gi: 1474891938
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GGO_A   9 SkVFPDLPEHQDNPSQLRLQHDGLATDDKARLEPMCLAEYLISGPGGMDPDIEIDDDTYDECREVLSRILEDAYTQSGTF 88 
Q8ZQ60  25 P-VFPDIPEHAPNPSRLRLAHDSLAINSEFRLEPECVVEYLISGAGGIDPDTEIDDDTYDECYDELSSVLQNAYTQSETF 103 Salmonella enterica s...
Q8ZMY7  25 SkVFPDLPEHQDNPSQLRLQHDGLATDDKARLEPMCLAEYLISGPGGMDPDIEIDDDTYDECREVLSRILEDAYTQSGTF 104 Salmonella enterica s...
6GGO_A  89 RRLMNYAYDQELHDVEQRWLLGAGENFGTTVTDEDLESSEGRKVIALNLDDTdDDSIPEYYESNDGPQQFDTTRSFIHQV 168
Q8ZQ60 104 RRLMNYAYEKELHDVEQRWLLGAGEAFETTVAQEHFKLSEGRKVICLNLDDS-DDSYTEHYESNEGRQLFDTKRSFIHEV 182 Salmonella enterica s...
Q8ZMY7 105 RRLMNYAYDQELHDVEQRWLLGAGENFGTTVTDEDLESSEGRKVIALNLDDTdDDSIPECYESNDGPQPFDTTRSFIHEV 184 Salmonella enterica s...
6GGO_A 169 VHALTHLQDKEDSNPRGPVVEYTNIILKEMGHTSPPRIAY 208
Q8ZQ60 183 VHALTHLQDKEENHPRGPVVEYTNIILKEMGHPSPPRMVY 222 Salmonella enterica subsp. enterica serovar Typhimurium
Q8ZMY7 185 VHALTHLQDKEDNNPRGPVVEYTNIILKEMGHTSPPRIAY 224 Salmonella enterica subsp. enterica serovar Typhimurium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap