Conserved Protein Domain Family
DUF1358

?
pfam07096: DUF1358 
Protein of unknown function (DUF1358)
This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369206
View PSSM: pfam07096
Aligned: 7 rows
Threshold Bit Score: 145.311
Threshold Setting Gi: 74800776
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7PVW6         1 VEQPGRTvptleeqaEKRRKFRYRAGAFLAAVGATSAVAGFSKAIMSAKKSDPKYFDKGL-HGSLALHEAGTSLALRALG 79  Anopheles gambi...
EDW30640       3 EAGANAD--------AVTADKERKFRIQGAAFLGLVGGISALFGFSRTLATAKKADSKVLqQQGTRQGIILMDEGATLAL 74  Drosophila pers...
Q16SN0         2 EHPAGSEpgs---hrTEMSDEERKFRYRASAFLAGVAGIAAVAGFSKTIMMAKKSDPQFF-ERGVQGSIAMQETGASLAM 77  yellow fever mo...
Q9NWH2        10 QPASGLE--------APGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWF-NKGSMATAALPESGSSLAL 80  human
NP_001016041  10 QSLASET--------GPGRAGEKLFLIKGGIFLGMVATAGMLAGFGTTLSLAKKRSPNWF-NKGVAATATLPESGSSLAL 80  tropical clawed...
Q4V8S3         6 ASASGAV--------SDIVEDDKSHLIKGGAFLATVATAGMIAGFGATLAVAKKKSPDWF-NKGIIGSAAVPESGASLAL 76  zebrafish
XP_027895635   9 DSVVRAN--------RDTDEKDGHHVLKGAVFLTTVASAGMIAGFGSTLALAKKKSPDWF-SKGVAATAAAPESGASLAL 79  Monterrey platy...
Q7PVW6        80 WGTLYAILGTGTICFGIWKLSGAKNMEEFRQAVGSAFPRVPRND 123 Anopheles gambiae str. PEST
EDW30640      75 RALGWGTLYAVLGTGAFCYGFWKLSGAKDFQEFRMKMGNALPRI 118 Drosophila persimilis
Q16SN0        78 RALGWGTLYAFLGTGTICYGIWKLTGASNMQEFRESIGNIFPRI 121 yellow fever mosquito
Q9NWH2        81 RALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTI 124 human
NP_001016041  81 RALGWGSLYAWCGVGLISFAVWKALGVHSLKEFREKMQSIFPSV 124 tropical clawed frog
Q4V8S3        77 RALGWGSLYAWCGVGLLSLTIWKAMGVHSLQEFRQKMQSIFPAI 120 zebrafish
XP_027895635  80 RALGWGSLYAWCGVGLLSVAVWKALGVHSLAEFRQKMELFFPAI 123 Monterrey platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap