Conserved Protein Domain Family
DUF1356

?
pfam07092: DUF1356 
Protein of unknown function (DUF1356)
This family consists of several hypothetical mammalian proteins of around 250 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399822
View PSSM: pfam07092
Aligned: 13 rows
Threshold Bit Score: 348.246
Threshold Setting Gi: 344267874
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003405790  20 DNRDDLLAEREQEEAIAQFPYVEFTGRDSITCLTCQGTGYIPTEQVNELVALIPHSDQRLRPQRTKQYVLLSILLCLLAS 99  African savanna...
Q5EA90        27 SKAASYSSMGNSRPFFSCVPCERAAGAGFVTCPTCQGSGEIPRELEKQLVALIPYGDQRLKPRHTKLSVFLAVSICLVTS 106 cattle
Q5BK83        27 SKAANYFSTGNRKPSHSCVPCEKAASTSFVTCPTCQGNGEIPQELEKQLVALIPYGDQRLKPRRTKLSVFLAVTICLLIF 106 Norway rat
XP_007643368  27 SKPANYLSTGNSKPPCSGVLYARAAGAGFVICPTCQGNGEIPREQEKQLVALIPYGDRRLKPPHTKLSVFLAVIICLVTF 106 Chinese hamster
XP_003407328  27 AKATSYPSTRNSKHFFSCVPCEGAVGGSFLTCPTCQGSGQIPRDMEKQLVALIPYGDQRLKPRHMKLFLFLAVLMCLVTS 106 African savanna...
XP_011215044  27 GKAACYSSTRSSKSFCSRMPGEGAASASYVTCPTCQGSGEIPQELEKQLVALIPYGDQRLKPRRTKLFVFLAVLICLVTS 106 giant panda
XP_007482200  28 SEASSYSSIDGSQSILTCVPC---TGSGFVTCPTCQGKGEIPSEQEKQLVALIPYGDQRLKPRRTKLYVSLAVMICLFTS 104 gray short-tail...
Q28DM0        23 GEDDDLLDGKNREQDIAQFPYVEFTGRDSITCPSCQGTGCIPTEQVNELVALIPYSDQRLQPQRTKLYVLLSVILCLLIC 102 tropical clawed...
XP_007232403  20 KPKEPDSDTDEDKHDISQFPYVEFTGRDSVTCPTCQGTGRIPREQENQLVALIPYSDQRLRPRRTKLYVSVSVLVCLLLS 99  Mexican tetra
XP_014989471  30 LVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLS 109 Rhesus monkey
CAF93247      24 PLEDSHDEEDGKGGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVSASVLVCLLLS 103 spotted green p...
XP_003768200  27 SEASSYSSINGSKSVLPCAPCTGAATSSFVTCPTCQGTGEIPSELEKQLVALIPYGDQRLKPRRTKLYVSLAVFTCLLMT 106 Tasmanian devil
XP_029306834  22 sGEYRDGEEDGKNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPSRTKLYVTISVALCLLLS 101 Cottoperca gobio
XP_003405790 100 GLVVFFLFPHSVLVDDDGIKVVKVLFNkeDSLVILAITATLKISNSNFYSVAVTSLSSQVQYMNTVVGTYGTTNVSLIPP 179 African savanna...
Q5EA90       107 SLIIFFLFPRTIAVQPVGLNSSTVATD--EANVYLNITSILNISNNNYCPITVTQLTIEVLHLSLVVGQVSHSLLLHIGP 184 cattle
Q5BK83       107 SLTIFFLYPRNIVVHPVGLNSSTVAFD--ETHVQLNMTNVLNITNSNFYPVTVTQLTAEVLHQTSVVGQVTSSLRLHIGP 184 Norway rat
XP_007643368 107 TLTIFFLYPRSIAVYPIGLNSSMVTFD--ETHIRLSMTNILNISNSNFYPITVTRLTAEVLHQTSVVGQVTSSLRLHIRP 184 Chinese hamster
XP_003407328 107 ALIFFFLFPRSLAVQPAGLNSSTVAFD--EADIHLNITNVLNISNRNYYPITVTQLAIQVLYMSLVVGQVSKSLLLPIGP 184 African savanna...
XP_011215044 107 SLIVFFLFPRSIAVQPAGLNSSTVAFD--EADIHLNITNILNISNSNYYPITVTQLTIEVQHLSLVVGQVTNSLLLHVGP 184 giant panda
XP_007482200 105 ALIFFFLFPRSILVQPAGLNSSGVAFV--DGIILLNTTNVLNITNNNYYPITVTQLNIEVLHLSLVVGQIKVSHLLHIGP 182 gray short-tail...
Q28DM0       103 GLVVFFLFPRTVLIEDGGIKMVKVWFDteNKVVILGMTSTLKISNSNFYSVSADSLTSQVQYMNTVIGTQQNSNVTLVHP 182 tropical clawed...
XP_007232403 100 GLAVFFLFPRTIDVTYIGVRSSYVTFDteNRIVYLNITNTLNITNNNYYPIQVTNVTAQVQFYKTVIGKSLVSNVTSIVP 179 Mexican tetra
XP_014989471 110 GLAVFFLFPRSIDVKYIGVKSAYVSYDvqKRTIYLNITNTLNITNNNYYSVEVENITAQVQFAKTVIGKARLNNITHIGP 189 Rhesus monkey
CAF93247     104 GLAVFFLFPRSIDVSYVGVKSVFVSYNkdKRSVYLNITNSLNITNNNYYTVEVANVTAQVQFAKTVIGKSRLSNITAISP 183 spotted green p...
XP_003768200 107 SLIIFFLFPRSILVQPAGLSSSEVAFT--DHSILLNVTNVLNITNNYYYPITVTQLNIEVLHLLLVVGQMEESILLHIGP 184 Tasmanian devil
XP_029306834 102 GLAVFFLFPRSIDVSYVGVKSAYVSYDldKRIVYLNITSTLNITNNNYYTVSVTNITAQVQFSKTVIGKAKLNNSSVIIP 181 Cottoperca gobio
XP_003405790 180 RSEQLVNFTVNAEMGGPFSYvyFFCTLPEILVHNIVIFMRTSVKISYIGHMTQSSLETHHYVDCGANST 248 African savanna elephant
Q5EA90       185 LASEQMFYAVTNRINDENTY--KICTWLEIKVHHVLLYIQGTLTYSYLSRSEQLVFQSYEYVDCRGNTS 251 cattle
Q5BK83       185 LASKQMPYEVASRILDENTY--KICTWPKIRVHHILVNIQGALTCSYLTHPQQLPFESFEYVDCRENMs 251 Norway rat
XP_007643368 185 LASEQMPYKVASSILDENTY--KICAQLKVKVHHILLHIQGTLTCSYLSHPQQLPFESFEYVDCKENMs 251 Chinese hamster
XP_003407328 185 LTSEQMFYTVASRIWDENTY--KTCTWLKIKVHHVFLHIQGTLTSSYLSHSEQLVFQSYEYVDCRGNSS 251 African savanna elephant
XP_011215044 185 LASEQMFYAVANKIWDENTY--KVCSWMKIKVHHVLLHIQGTLTCSYLSHSEQLVFQTYEYVDCRGNTS 251 giant panda
XP_007482200 183 LDSEQMFFAVTSKISDENTY--NICSWMKIKVHNVLLHTQGTLTCSYLSHTEQLAFQSYNYVDCRGNKs 249 gray short-tailed opossum
Q28DM0       183 LSEKQVNFTVKAELGNTLSYlyYFCTLPSVKVHNIVVFMRTSVKFSYIGHVSQSSLETYQYIDCGANST 251 tropical clawed frog
XP_007232403 180 LDMRQVDFSVPTVIANEINYifDFCTMQSIKVHNIVVMMQITVTTVYFGHAEQISQEKYLYVDCGSNTT 248 Mexican tetra
XP_014989471 190 LDMKQIDYTVPTVIAEEMSYmyDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTT 258 Rhesus monkey
CAF93247     184 LDMKQIDYMVPTILGDELNYmyDYCTLQTIKVHNIVVMMQVTVTTTYFGHAEQVSQEMYQYVDCGGNTT 252 spotted green pufferfish
XP_003768200 185 LSSEQIIYSVTSKIDDENTY--NICTWLKIKVHNVLQHIRGTLTCSYLSHTEQLAFQSYDYVDCRGNTS 251 Tasmanian devil
XP_029306834 182 LDERQIDYTVPTTIADEMSYmfDYCTLPTIKVHNIVVMMQVTVTTSYFGHAEQVSQEMYQYIDCGGNTT 250 Cottoperca gobio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap