Conserved Protein Domain Family
DUF1350

?
pfam07082: DUF1350 
Protein of unknown function (DUF1350)
This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis.
Statistics
?
PSSM-Id: 115718
View PSSM: pfam07082
Aligned: 3 rows
Threshold Bit Score: 463.557
Threshold Setting Gi: 81670551
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P73194   2 EWREISGSWVLVPPQPIAVVHFLGGAFVGTAPNVAYRWLLTELGKAGYVVVATPFVNTFDHQAIARSVLNRFEIILERLQ 81  Synechocystis sp. PCC...
Q8DG48   2 EWQEVRGNWLCIPQRPLGWIHFLGGAFVAAAPQLTYRRLLEHLAEANYGIIATPFVNSFDHGAIALDALNKLDYALDWLV 81  Synechococcus elongatus
Q8YXX2   2 DWKEIRGNWVLVPRNPVGIIHFLGGAFVATAPHLTYRWLLEQLGNKGYVVIATPFVNTLDHIAIANSVLLNFERTIERLH 81  Nostoc sp. PCC 7120
P73194  82 KQGEITTGlLPVYGLGHSLGCKLHLLIGSLYEVERAGNILVAFNNYPVKQAIPFgeqlaqlqLDKFLTGvqkqlrqlnlq 161 Synechocystis sp. PCC...
Q8DG48  82 HRQGYPPA-LPIYGLGHSMGCKLHLLINSLYDGDRAGNMFMAFNNYPASQSIPW--------MDNLGPA----------- 141 Synechococcus elongatus
Q8YXX2  82 DSGALRKLyLPTYGIGHSMGCKLHLLIGSLFPVERAGNILISFNNYAAKDAIPL--------VEQFNTTl---------- 143 Nostoc sp. PCC 7120
P73194 162 vdlNFEFTPSPEETNLLIAENYRVRRNLLIKFSNDDIDQTLGLRPILNQQTADLVAYCPLPGNHLTPLGQDIQWETGQEF 241 Synechocystis sp. PCC...
Q8DG48 142 ---SVEFTPSPTETEHFIQKRYPVRRNLLIRFQDDDIDQTARLRSLLRAKFGDMVTALKLPGNHLTPLSQDLKWQVGAEF 218 Synechococcus elongatus
Q8YXX2 144 ---AIEFTPSPLETNKLVQESYNVRRNLLIKFNNDNLDQSAALTKILQVRFPEMVTAQTLPGTHTTPLGQDVKWQTGSSF 220 Nostoc sp. PCC 7120
P73194 242 SPLDAVGQWLKNSLSQDLRRLQKEILRWLEP 272 Synechocystis sp. PCC 6803
Q8DG48 219 SPLDALGQWIKQSLFPEMPVLEACLLEWLNP 249 Synechococcus elongatus
Q8YXX2 221 TPFDALGQWFKQEVYRDLNQLNRAMLLWLNP 251 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap