Conserved Protein Domain Family
FYTT

?
pfam07078: FYTT 
Forty-two-three protein
This family consists of several mammalian proteins of around 320 residues in length called 40-2-3 proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 399813
View PSSM: pfam07078
Aligned: 3 rows
Threshold Bit Score: 462.479
Threshold Setting Gi: 556982103
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005997408   8 AAGPGPANPGGSGAAGLDKIDMSLDDIIKLNRKEQRQlkmalpargRSWPSKNKRIQQSRAQPLWRRGiWRGTQQGKGAG 87  coelacanth
Q17QU6        12 TATPPPAPPKARSNENLDKIDMSLDDIIKLNRKEGKK---------QNFPRLNRRLQQSSARQFRMRV-RWGIQQNSGFG 81  cattle
XP_020841689  12 VATPP--PLKTSSHENLDKIDMSLDDIIKLNKKEERK---------QNFPKLNRRLKHTGARQFRMRVaRWGLQQQTGFG 80  koala
XP_005997408  88 PgvHRLGPRGKKTTavGKRPSQGVITGLAARRAGALRKGISPLNRPVLNAKqNVARTRPALQRRAT-PRQYELQRRQLAP 166 coelacanth
Q17QU6        82 K--NSLSRRGRVMP--GKRRPYGVITGLAARKATGIRKGISPMNRPPLSDK-NIERYFPALKRKANlLRQNEVQRKPVAA 156 cattle
XP_020841689  81 K--NGLGRRGRMGP--GKRRpYGVITGLAARKANGIRKGVSPISRPPLSEK-NIQRYYPMLKRKTNlQRQNDMQRKPIPV 155 koala
XP_005997408 167 LRRPAQLRRRNFGPAGASRPGaqvrNPVPQQKEARQATFLFRRG---------LKVQTQVHVGRGPSRtPNPQRTRPWRT 237 coelacanth
Q17QU6       157 LKRPNQLNRKNNIPNNFTRSG----NKLSHQKDTRQATFLFRRG---------LKVQAQLNSEQLLDD-VVAKRTRQWRT 222 cattle
XP_020841689 156 LRRPNQL-RRNNVPVNFTRNG----TKLNQQKDT-RQATFLFRRgxeqllclfFQVQAQVHPGQLLDK-PTAKRTRQWRT 228 koala
XP_005997408 238 STTNGGILTVSIDNPGALQHqPVSPRPRITRPAMPPFILKKESAEEKKIPKGVPLQFDINSVGKQTGMTLNERFRILKDQ 317 coelacanth
Q17QU6       223 STTNGGILTVSIDNPGAVQC-PVTQKPRLTRTAVPSFLTKRDQSDIKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQ 301 cattle
XP_020841689 229 STTNGGILTVSIDNPGAIHP-SVAQRPRLTRTPIPSFLMKRDHPEEKKIPKGVPLQFDINSVGKQTGMTLNERFGILKEQ 307 koala
XP_005997408 318 RTTLVSpQSKGSRFVTVG 335 coelacanth
Q17QU6       302 RATLTF-NKGGSRFVTVG 318 cattle
XP_020841689 308 RIALTQ-NK-GSRFVTVG 323 koala
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap