Conserved Protein Domain Family
DUF1344

?
pfam07076: DUF1344 
Protein of unknown function (DUF1344)
This family consists of several short, hypothetical bacterial proteins of around 80 residues in length. Members of this family are found in Rhizobium, Agrobacterium and Brucella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399811
View PSSM: pfam07076
Aligned: 8 rows
Threshold Bit Score: 86.3071
Threshold Setting Gi: 123162677
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q11KE6                 19 AADAEGKIASVDPKAMTITLDDGATYKLPPETDVEAISDGAEVVIAYQVDDnGERQITDM 78  Chelativorans sp. BNC1
goetting:NGR_c05190    24 SADVEAVITNIDTEQLSLSLDDGKSYQAPEEFNFEGLEAGVKVLVFYTEVD-GKRVINDL 82  Sinorhizobium fredii NGR234
vbi:Arad_1215          69 SADVQSTIKKVDAKNFSITLDDGKNYQAPEDFDFSGLKPGVKVDVFYTEVD-GKRVINDL 127 Agrobacterium radiobacter K84
TriplettUF:B488_02940  23 tlDITAHVREIKPNSLSLVLDDGKTYQVSEEFNFDGLQVNNKVIVRYTVVN-GKRMINDL 81  Liberibacter crescens BT-1
Q8UHC7                 38 SVDVEGTISKIDANGLSITLNDGKTYRVPEEFNFEGLKAGVKVVVFYTEVD-GKRVVDDL 96  Agrobacterium fabrum str. C58
vbi:Avi_1019           24 SDDVESIIKSISTEKLTLTLEDGKTYSVPAEFNFDGLTTGVKVVVYYTMVD-GKRVVDDL 82  Agrobacterium vitis S4
zhongguo:SL003B_3315   20 ADESEGKIVRIDPETATISLSDGNDYAFPLDFYIDDLQPGMTVRVFFDVEN-GKKVLYDL 78  Polymorphum gilvum SL003B-...
Q2YMF9                 21 AEDAEGKITDINKDSETITLDDGETYKLPGEFDIGAINPGMKVLIIYDIVD-HTRFITDI 79  Brucella abortus 2308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap