Conserved Protein Domain Family
TRAP-gamma

?
pfam07074: TRAP-gamma 
Translocon-associated protein, gamma subunit (TRAP-gamma)
This family consists of several eukaryotic translocon-associated protein, gamma subunit (TRAP-gamma) sequences. The translocation site (translocon), at which nascent polypeptides pass through the endoplasmic reticulum membrane, contains a component previously called 'signal sequence receptor' that is now renamed as 'translocon-associated protein' (TRAP). The TRAP complex is comprised of four membrane proteins alpha, beta, gamma and delta which are present in a stoichiometric relation, and are genuine neighbors in intact microsomes. The gamma subunit is predicted to span the membrane four times.
Statistics
?
PSSM-Id: 399809
View PSSM: pfam07074
Aligned: 15 rows
Threshold Bit Score: 204.158
Threshold Setting Gi: 198428205
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6DEU2        12 EEDLLLQDFSRNLSAKSSALFYGNAFIVSAIPIWLYWRIWHMDLVQSAVLYTVMTLVSTYLVAFAYKNVKFVLKHKVAQK 91  tropical clawed...
XP_001951873  14 EEEQLLSDFSRNVSTKSSALFYGSAFMVSALPIWLYWRIHMIEMLPALVWFILVTLGSTYLISFAYKNTKFILKHKIAIK 93  pea aphid
EDO39583      10 EDELLLQNFSRSVSTKSSILFYANALIVSAIPLWLFWRIHQMDPYSSGILFAVMTLVSTWLVAFAYKNVKFQLKHKIAQR 89  starlet sea ane...
XP_002066423  17 EEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIASR 96  Drosophila will...
EEC13285      91 EEELLLQDFSRNVSTKSSALFYGNAFIVSAIPIWLFWRIHQMDLYQSAIVFAVMTLLCTWLIAFAYKSVKFVLKHKVAPK 170 black-legged tick
Q1HRN7        12 EEELLLQDFSRNVSTKSNALFYGNAFMISAVPIWLFWRVHQMELLPSLVFFAIVTGLCTYLMAMAYKNTKFTLKHKIANK 91  yellow fever mo...
OWR42219      12 EEELLLQDFSRNVSTKSSALFYGNAFIVSAIPIWLFWRVHALEVSSSLAWFAIVTVASTWLLALAYRNTKFQLKHRVAVR 91  Danaus plexippu...
XP_002131637  11 EEELLLQDFGRDLSRKSSVIFYVHALFVSAIPLWLFNRIHQMEMLDNAILFVIGTIFSAYFVALAYKNNKFELKHKIAQK 90  vase tunicate
CAP34679       7 EEEMLLSSYSASSSTKGTLFFYVNALILSLAPLYLFYGVHQMEVADSLVVWTLSAAGTAYLLVMACKNQKKLLKHQIVMK 86  Caenorhabditis ...
EFO20117      12 EDELLLKDFSAAVSTKGSALFYGNSTVIAIAPLYLFHGIHQMEVADSWIIWLISSLTASYLISFAYKNIKHILKHKIVVK 91  eye worm
Q6DEU2        92 REDAVSREVTRKLseADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFLLKNFNPTVNYILSIS 171 tropical clawed...
XP_001951873  94 REEAVTREITRKY--ADDKKISKKEKDEKALFQKNDVADYEATAFSIFYNNALFLVIVVLLSFYLLKGFSTTANYIFSVG 171 pea aphid
EDO39583      90 RDAAITKEVNQEL--DPNKKLTRQEKDERILWKKNKVADMEAMTFSIFYNNALYLFLVLFASFYALRSLHPSANYLLSTS 167 starlet sea ane...
XP_002066423  97 REEAVTREVNRQL--GDDKKVTRKEKDERILWKKNEVADYEATTYSIFYNNALFLAIIIFISFFLLKNISPFVNYIFSIG 174 Drosophila will...
EEC13285     171 REDAVSREIMKKL--SDDKKMSKKEKDERILWKKNEVADYEATTFSIFYNNALFLTLIIVTSFYILRAFSPMVNYVFSVG 248 black-legged tick
Q1HRN7        92 REDAVTREMTALL--ADDKKISRKEKDERILWKKNDVAEYEATTFSIFYNNALFLAVVIFASFYLLRSFTPTFNYILSMA 169 yellow fever mo...
OWR42219      92 REDAVAREMARKL--ADEKKMSRKEKDERILWKKNEVADYEATTFSIFYNNALFLTIVILASFYLLRSFTPTVNYIVSLT 169 Danaus plexippu...
XP_002131637  91 RSDGVAAELNAKMseSESKKISKKEKDERILWRKNEIAEAESMQLAVFYTNSLFLILLILSSFFFFKSYSPMPNYIISMV 170 vase tunicate
CAP34679      87 RGPAVDREINTKF--ASDKKMTIKEKEERALFRKNEVADTESTYLSVFYTNTLFLTIMLISAFFLLANLAPVFNLLISTI 164 Caenorhabditis ...
EFO20117      92 RSEAVTREMNRKL--ADDKKMSKKEKDERILWKKNEVGDYEATTFSIFWNNILFLSLLLILSFFLFASISSTFNCLFSMV 169 eye worm
Q6DEU2       172 AASGLIALLSTG 183 tropical clawed frog
XP_001951873 172 IASGLIALFSTG 183 pea aphid
EDO39583     168 VAGGILALLSTG 179 starlet sea anemone
XP_002066423 175 LASGALALFSTS 186 Drosophila willistoni
EEC13285     249 GAAGLLALFSTG 260 black-legged tick
Q1HRN7       170 GASGLMALLSTG 181 yellow fever mosquito
OWR42219     170 VASGLLALLSTG 181 Danaus plexippus plexippus
XP_002131637 171 GASSITGLLSTS 182 vase tunicate
CAP34679     165 GSAALVAFLSTA 176 Caenorhabditis briggsae
EFO20117     170 GAAGLVALFSTA 181 eye worm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap