5CL2


Conserved Protein Domain Family
Spo0M

?
pfam07070: Spo0M 
Click on image for an interactive view with Cn3D
SpoOM protein
This family consists of several bacterial SpoOM proteins which are thought to control sporulation in Bacillus subtilis.Spo0M exerts certain negative effects on sporulation and its gene expression is controlled by sigmaH.
Statistics
?
PSSM-Id: 399805
View PSSM: pfam07070
Aligned: 82 rows
Threshold Bit Score: 210.042
Threshold Setting Gi: 307217397
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5CL2_B                5 AGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEE 84  Bacillus...
jgi:Deima_1471       11 VGVGGARVDARLERDAVRLGEDLRGVVLLSGGAVEQNIERLNFSLMTLARHDDT----TSAHAVARVTLGERVTLRAGET 86  Deinococ...
ACO45518             11 VGVGAARVDTRLSSAEVRVGEELRGTVHVQGGQVEQQVERINVGLATRYKHDDS----YVNHTLQSEVVVPAFTIRPGET 86  Deinococ...
zhongguo:DGo_CA2346  11 VGIGAARVDTRLSRPEARVGERLSGVVAVQGGRVEQRIERVNLGLATRYRSDDS----TVTHTLFSQPVVPGFTIRPGET 86  Deinococ...
jgi:Deipe_2627       11 VGIGNATVDTQLAQVSVRLGEQVEGKVVVRGDQAPQAIEHIELFVLAGNSDQ------VNMHEVQRARVCGPLEIAPGEE 84  Deinococ...
WP_012748940          9 LGVGAAKVDLVLHHPHVRLGEKLEGEFFIEGGTVEQRIRKLEVELQLIVQTNGK----AYRRTVAVIPVSPSFTIQPGER 84  Bacillaceae
Q5L3I0                9 FGIGAAKVDLVLHRPHVRLGETLEGEFLLEGGSVAQHIRNLDVVLQLEVHAEGK----AYRRTAAVIPVASSFTIQPGER 84  Geobacil...
jgi:TherJR_1152       9 VGIGSAKVDLEIPNPQVELGGILEGVVKIKGGSVEQEIEKIYINLVLNSKYGSGDETKPVSRTVGTVKVTDKLTLAPGQE 88  Therminc...
jgi:Desku_2866        9 IGIGSARVNLEVAGTAVPLGGILNGTIRIQGGNVEQQVDKIYINLILSSAYKAGDQTRNIRRIIGTVTVGEKMVVRPGEE 88  Desulfof...
Q3IE37                9 VGIGAAKVDTILETEHLQPGQLFNAQIVITAGDVSQEIAGLDLLLMTRVKASNEDGDYFTNHVIEQWRITDIGTVEPGEV 88  Pseudoal...
5CL2_B               85 HQFPFTFTLPLDTPIT---VGKV--EVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPyf 159 Bacillus...
jgi:Deima_1471       87 RELPFHLTVPYHAPIS---APGV--RLWLHTDADIAGASDPGDEDSVRILPNAPTQAFLDALSALGFHLKSGTVEFTHg- 160 Deinococ...
ACO45518             87 REFPFTLRVGPGTPLS---LPGS--DVWVFTDADIAGGVDPGDQDPLRVLPSAGMEAVIGAALRLGFSLKAAETEYAHg- 160 Deinococ...
zhongguo:DGo_CA2346  87 REFPFELPVPHGTPLS---LPGS--EVWLVTDADIEGAADPGDTDGVWIRPSEDMETVIQAAQDLGFRLQRSETEYRFg- 160 Deinococ...
jgi:Deipe_2627       85 RVLPFEFVLSYHTPLS---LRGT--RVGVQTGVSVRLAVDLNDHDLLEVQPSAPVQTLLDAAELLGLRLSRSYVDYAPar 159 Deinococ...
WP_012748940         85 KVLPFSYVLPLHLPIT---RPSV--GYTFVTRLDIADGVDAFDQDAIRILPPLSLEKLFHAFEKLGFREKPSS------- 152 Bacillaceae
Q5L3I0               85 KVLPFSYALPLHLPIS---RPTV--RYTFVTRLDIADGADAYDQDAIHILPPTALEQVFSALAALGFREKATS------- 152 Geobacil...
jgi:TherJR_1152      89 KTIPVNFEIPLDIPIS---KGRT--RYYLKTGLDIEQALDPTDLDDIKILPNKYMKMLFDAVSALGFREKHNSGDYNG-- 161 Therminc...
jgi:Desku_2866       89 KVYPVSFQIPFGLPIS---RGRT--RYFLQTGLDIPQAIDPVDHDPIQIVPNREFKMFFDALKVLGFREKPGCGDYNG-- 161 Desulfof...
Q3IE37               89 KTIPFQARLHSETPITeinAGYNqsYVWLETGLDIDLALDPSDKDHLHVYPNEAVKTCMQAMEKLGFSLTKADVEKGHlr 168 Pseudoal...
5CL2_B              160 -qR---RLPFVQEFEFVPtSGYYRQMLDELELIFLLDEDGLEIIFEVD-RRA 206 Bacillus subtilis subsp. subtilis st...
jgi:Deima_1471      161 --------rLVQELEFAPpHGQ--GHITELEVVLLPGAQHLDVRLEVD-RRA 201 Deinococcus maricopensis DSM 21211
ACO45518            161 --------rLVQELSFRPpHGQYK--LTELELVMLPANGGLDVILEVD-RRA 201 Deinococcus deserti VCD115
zhongguo:DGo_CA2346 161 --------sVVQELSFRPpAGQYR--LTELELAFFPAPGGLDLLLEVD-RRA 201 Deinococcus gobiensis I-0
jgi:Deipe_2627      160 -------rrPAQQLEFLA-PDTYG--VKEVELLLSVEPDRIDVTLEVD-RRA 200 Deinococcus peraridilitoris DSM 19664
WP_012748940        153 --Gk--ITAYGQEFAFFP-TEVFKGTVQEVEFSAFIEENGIRLFLEVDvWSG 199 Bacillaceae
Q5L3I0              153 --Gs--ITPHGQEFAFFP-TSEFQGIVQEVEFFALVEGEGVRLYMEIDvRHG 199 Geobacillus kaustophilus
jgi:TherJR_1152     162 ---------RYQEFEYRP-TSFMARELDEIELYPTAGEQELNVVIQID-KRN 202 Thermincola potens JR
jgi:Desku_2866      162 ---------RFQEFEYRP-TTYFARELDEIEVYPVAGERELVVVMQLD-KKA 202 Desulfofundulus kuznetsovii DSM 6115
Q3IE37              169 asTfqsVSGCYQELEYKP-NSRSLFGVKEIELSFIPEAHKTHVLIELD-RAF 218 Pseudoalteromonas haloplanktis TAC125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap