Conserved Protein Domain Family
RIC1

?
pfam07064: RIC1 
RIC1
RIC1 has been identified in yeast as a Golgi protein involved in retrograde transport to the cis-Golgi network. It forms a heterodimer with Rgp1 and functions as a guanyl-nucleotide exchange factor.
Statistics
?
PSSM-Id: 399802
View PSSM: pfam07064
Aligned: 72 rows
Threshold Bit Score: 129.627
Threshold Setting Gi: 354543828
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF53464      856 LENSLWGYDGSS----IKLWLDALRIPSAdpDeslrsnddedqeeeqdqlpEYKtIE-SSVSMPL------DFYPLCVLL 924  Ustilago hordei
Q54WR7        719 IGNTLWAYGNSG----IQVWFPFSSE---------------------------EiLSnKNFNHNKslsfnnEVYPIGFLN 767  Dictyostelium...
NP_001319814  630 VEEVSWLDYGHRg---MQVWYPSLGDDPFmqEd------------------FLQ-LD-PELEFDR------EVYPLGLLP 680  thale cress
XP_002967485  984 EEISWWAYGHQG----MQVWYPS------------------------------SlSAdKTSQLDPeigfdrEVYPLALCP 1029 Selaginella m...
Q29DM2        707 MRDCLWLYSGAHg---MRVWLPI--------Lppgrerreq--ggaqrlhsFMS------KRIMLsf--plKVYPLVILF 765  Drosophila ps...
XP_002114344  720 LTDALWLGCGADg---MKVWLPL--------Ypsseg----------kqpnFVA------KRIMLpf--klDVYPQAVLF 770  Trichoplax ad...
Q4DY34        692 GINFLHLLGGEDdteiFPVVHEYAV----------------------------SeFDaESIPVGLstyngcLFTAFSTRE 743  Trypanosoma c...
CAM42881      998 LRPILYA---------HRIL---------------------------------------------------SLLLLEAMP 1017 Leishmania br...
CCE40550      718 pvqfIYLFNGDQ----ILIYDVDEMVAKAcnKlhvn-----------qedaFESeDEsELVPIAIdt---dDILPLEIET 779  Candida parap...
XP_013932649  715 ceiwLYDFTNEKn---MMKILPIAVQTG-------------------------NqTQvRENGVLVvesngtNSYPLTMLS 766  Ogataea parap...
CCF53464      925 EKGIV--LGIESE---------------VSLRRSLDFALWRTGTNTH-------------------------LFLHQLLR 962  Ustilago hordei
Q54WR7        768 ELGVI--VGLSQG---------------ISYSSCSVYPNYEIHIKTH-------------------------PFLHSILK 805  Dictyostelium...
NP_001319814  681 NVGVV--VGVSQR---------------MSFSASAEFPCFEPTPQAQ-------------------------TILHCLLR 718  thale cress
XP_002967485 1030 SAGVL--VGVSQR---------------LSVSTCSEMPCFEPIPQAE-------------------------TILPCLLH 1067 Selaginella m...
Q29DM2        766 DNVIV--LGVENEstl----------ytNESTSHFSVPFALMERKSQ-------------------------IYLHKVLR 808  Drosophila ps...
XP_002114344  771 EEAVI--LGASNEtid----------lkSPGKSDVTFPFYSIDRTTQ-------------------------IYLHHILR 813  Trichoplax ad...
Q4DY34        744 VIGSI--GGTSST---------------VSLRISLKPLLYNFCVLTAltcmglpsletvnkktpsnvnpfplLMWNDHLL 806  Trypanosoma c...
CAM42881     1018 SSLVPprVFSTQDvsassfaartisrqsSRFEGGATCAVATASAISSshaaev-------------ddrvvtFMWDRNFF 1084 Leishmania br...
CCE40550      780 DRNTInlIGLENL--------------------SSSYHHHDFVIKNKla---------------------hkLILNNFIE 818  Candida parap...
XP_013932649  767 DKNMI--FGIEID--------------------SAQGSNLKVEPTRK-------------------------NYLNNVLD 799  Ogataea parap...
CCF53464      963 NYL------EKGLLEEAVFFAASYQDLVYFAH---ALEILLH-AVLEDEAdaglgealysrkrsgsvlqkersassllad 1032 Ustilago hordei
Q54WR7        806 HLL------ERGGAEKAWNLSSKFYTIPHFTH---SLELLLH-EFISETDdlkkqfki---------------------- 853  Dictyostelium...
NP_001319814  719 HLL------QRDKNEEALLLAQLSAEKPHFSH---CLEWLLF-TVFDAEIsrpnpnr----------------------- 765  thale cress
XP_002967485 1068 HLL------QRNKQDEALQLAKLSARNPHFSH---SLEWLLF-RVFDGAIfrqnpk------------------------ 1113 Selaginella m...
Q29DM2        809 QLI------KRNLGYSAWEIAQSCRALPYFPH---ALELLLH-EVLEEEAtskqp------------------------- 853  Drosophila ps...
XP_002114344  814 QLL------RRNLDVHAYEVARCCMSLPYFSH---ILELMLH-EVLEEEAtasep------------------------- 858  Trichoplax ad...
Q4DY34        807 YWL------------------ESMRRNGTFIP---NADYFLH-TLISETIlcs--------------------------- 837  Trypanosoma c...
CAM42881     1085 HWL------------------EYMRLNDTFSA---VFDYFLH-TALNDSPpaa--------------------------- 1115 Leishmania br...
CCE40550      819 FDLi-----HRG------DLESTFNKYKSFANfqfCLELLLFkLLVGGEQqhq--------------------------- 860  Candida parap...
XP_013932649  800 HYIrlnlevDQGNNNNILSLSSIYKRFHRFKHfvfVLELLLM-NYIQKSYegh--------------------------- 851  Ogataea parap...
CCF53464     1033 vaeeendehqsgqgangsgihldlprnnqrrrssssrsgTSTPRAILPLVVEFL-DHFP-EALDIVVGCARKTEVARWAY 1110 Ustilago hordei
Q54WR7        854 --------------------------------ksqstgqLSPAGLKLEYVINFL-KKFP-QFPEVAMRATRKIDASLWRG 899  Dictyostelium...
NP_001319814  766 --------------------------------nqisgpgHLKKLSLLRKACDLI-KNFP-EYYDVVVNVARKTDARHWAD 811  thale cress
XP_002967485 1114 ----------------------------------snlevSTKKTSLLEQVCDLI-RNFP-EYPDVVVSVARKTDGRHWPL 1157 Selaginella m...
Q29DM2        854 -----------------------------------------ipdaQLPSILDFI-REFP-VYLETIVQCARKTEIALWPY 890  Drosophila ps...
XP_002114344  859 -----------------------------------------mpdaLLPRIVAFI-QEFP-SYYHIVVHCARKTEFDLWDY 895  Trichoplax ad...
Q4DY34        838 -------------------------------------ldHDSRLAAVQATVSLL-RRYS-EFYSVVVSCMRMLDVSQWRK 878  Trypanosoma c...
CAM42881     1116 -------------------------------------vqGLGRRSAVRATIALL-RNYP-EFYAIVVGCMRKMDFTRWRL 1156 Leishmania br...
CCE40550      861 -------------------------------------qqQQSSNLTLKRLFQLI--EFTeSPESIYINCLRKIEVAYWNK 901  Candida parap...
XP_013932649  852 -------------------------------------ddGPEYFDRLIKLIKMTgIEYP-----VYLNCLKKIEVHYWST 889  Ogataea parap...
CCF53464     1111 LFDVVG-APRLLFQKCIQADR-LRTAGMYL--LVL------------------------HNLEPL-----EVSI------ 1151 Ustilago hordei
Q54WR7        900 LYTIIG-DPFILYQKCLSNGK-IEIAASYL--KIL------------------------QHLNTN-----SNTSfqddis 946  Dictyostelium...
NP_001319814  812 LFSAAG-ISTTLFEDCFQRRW-YRTAACYI--LVI------------------------AKLEGV-----AVSQ------ 852  thale cress
XP_002967485 1158 LFAAAG-DSTKLFEECFERKS-YHTATCYI--LVI------------------------AKLEGP-----SVSQ------ 1198 Selaginella m...
Q29DM2        891 LFSMAG-KPKELFQLCLQSEQ-LDTAASYL--IIL------------------------QNLEPS-----VVSK------ 931  Drosophila ps...
XP_002114344  896 LFAAVG-NPKNMFEECLASGD-LETATSCL--IIL------------------------QNLEPS-----DVSR------ 936  Trichoplax ad...
Q4DY34        879 LLDVLG-SPLEFFRECIENRR-FEESAQLLrvIMLdgnf----------------pddgASVKSL-----EATM------ 929  Trypanosoma c...
CAM42881     1157 VLDFLG-TPTDLFHECVAHYC-YAEAVHLIrvIMMgtykpvatlsvnrvaelgssgcaaSDITPL-----QQAS------ 1223 Leishmania br...
CCE40550      902 FFNVLNtTPVKFMDRLIKLDN-VELCYHYL--IVYlnykkegepgdnenngkvedtyesGTVSHAnggegAAPDqlsgdd 978  Candida parap...
XP_013932649  890 FFTRYSeTPRDMLSKIYNVDKdFKLSAHYF--IIM------------------------LNYEQTdekigEKDV------ 937  Ogataea parap...
CCF53464     1152 -AHTIQLLKLAGAKGDWNTCHDLLRFLSSIDPTGGAL 1187 Ustilago hordei
Q54WR7        947 rKCAIELLEISLDFDNIDLVGDLIRFLHTSDEDNATT 983  Dictyostelium discoideum AX4
NP_001319814  853 -YCALRLLQATLDESLYDLAGELVRFLLRSGRDIEQA 888  thale cress
XP_002967485 1199 -RGALRLLQATLDEFMYELAGELVQFLLRIGREYENS 1234 Selaginella moellendorffii
Q29DM2        932 -QYATMLLDIALQQRKWELAKDLIRFLKAIDPNEIDS 967  Drosophila pseudoobscura
XP_002114344  937 -LHATLLLDTALAKHKWELAQDVVRFLRAAGPCSDTP 972  Trichoplax adhaerens
Q4DY34        930 -LCAVHLFVLALWRRNVPLVHDLLRFMALLHTELVSP 965  Trypanosoma cruzi
CAM42881     1224 -QCAVELFVLSVENGNYTAAYDIMRFMARLEEEIGMP 1259 Leishmania braziliensis MHOM/BR/75/M2904
CCE40550      979 kQIILQIIKMLAESEKWDWCFELCRFIKILEPSGQFL 1015 Candida parapsilosis
XP_013932649  938 -QLINDILVKLVLTKDFETSFELVRFIKLIDDKicnr 973  Ogataea parapolymorpha DL-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap