Conserved Protein Domain Family
DUF1331

?
pfam07048: DUF1331 
Protein of unknown function (DUF1331)
This family consists of several Circovirus proteins of around 35 residues in length. Members of this family are described as ORF-10 proteins and their function is unknown.
Statistics
?
PSSM-Id: 115686
View PSSM: pfam07048
Aligned: 3 rows
Threshold Bit Score: 46.97
Threshold Setting Gi: 81962329
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YR05  1 MSTAQEGVLTVVALTVYPKVRERRALKMPFFLFQR 35  Porcine circovirus type 2-E
Q9YQW9  1 MSTAQEGVVTVVALTVYPKVRERRVLKMPFFLLQR 35  Porcine circovirus type 2-B
Q91HA8  1 MSTAQEGVLTVVFLTVYPKVRERRVLKMPFFLLQR 35  Porcine circovirus 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap