Conserved Protein Domain Family
TrfA

?
pfam07042: TrfA 
TrfA protein
This family consists of several bacterial TrfA proteins. The trfA operon of broad-host-range IncP plasmids is essential to activate the origin of vegetative replication in diverse species. The trfA operon encodes two ORFs. The first ORF is highly conserved and encodes a putative single-stranded DNA binding protein (Ssb). The second, trfA, contains two translational starts as in the IncP alpha plasmids, generating related polypeptides of 406 (TrfA1) and 282 (TrfA2) amino acids. TrfA2 is very similar to the IncP alpha product, whereas the N-terminal region of TrfA1 shows very little similarity to the equivalent region of IncP alpha TrfA1. This region has been implicated in the ability of IncP alpha plasmids to replicate efficiently in Pseudomonas aeruginosa.
Statistics
?
PSSM-Id: 115680
View PSSM: pfam07042
Aligned: 2 rows
Threshold Bit Score: 615.5
Threshold Setting Gi: 458666
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P71176   126 KKRTAGGELAEKVSEAKQTALLKHTKQQIKDMQLSLFDLAPWTGSHAALPNDFGRSAIFTVRNKKVPRPALQGQSIYHVN 205 Klebsiella aerogenes
AAA16606 102 KRKTAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTRNKKIPREALQNKVIFHVN 181 Plasmid RK2
P71176   206 KDVEITYTGIELRADDDELVFAQVLEYANGTALGEPVSFTFYELCQDLDWSINGRYYTRAEECLTRLQASAMQFSSQRIG 285 Klebsiella aerogenes
AAA16606 182 KDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTFYELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVG 261 Plasmid RK2
P71176   286 RLESVSLIRRFRVLDRGKRTSRCQVEIDAEIVVLFAGDHYTKFVWEKYRKLSPNrDGRMFDYFATHKEPYPLKLETFRLM 365 Klebsiella aerogenes
AAA16606 262 HLESVSLLHRFRVLDRGKKTSRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPT-ARRMFDYFSSHREPYPLKLETFRLM 340 Plasmid RK2
P71176   366 CGSDSTRPKKWREQVGEACDELRENGLVESAWVNDDLVHCKR 407 Klebsiella aerogenes
AAA16606 341 CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR 382 Plasmid RK2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap