Conserved Protein Domain Family
DUF1326

?
pfam07040: DUF1326 
Protein of unknown function (DUF1326)
This family consists of several hypothetical bacterial proteins which seem to be found exclusively in Rhizobium and Ralstonia species. Members of this family are typically around 210 residues in length and contain 5 highly conserved cysteine residues at their N-terminus. The function of this family is unknown.
Statistics
?
PSSM-Id: 399788
View PSSM: pfam07040
Aligned: 51 rows
Threshold Bit Score: 111.569
Threshold Setting Gi: 123079716
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
goetting:Ngar_c34140  14 SNCNCDYACPCQFESrRPTH--GDCRGFAAVRIDKGHFGDVALDGLGAALLYAWPGPIYEGNGECQAVIDERADGKQRDA 91  Candida...
Q930H8                65 ASCSCDYGCPCEFNG-KPTE--GLCEGLECMLIEEGWFGDLRLDGLKVAAVYRWPGPVHEGGGVVRGFFDANADQAQIDA 141 Sinorhi...
WP_013831835          12 ANCNCEYGCNCQFGG-LPDK--GNCQAVFAMAIDQGIHGDTDLSGLNIAAVFSWPGPIHEGHGECAAFVDERATDAQRNA 88  Novosph...
Q11KF5                14 IHCSCAYGCPCQFAA-RPTQ--GSCRAVGFVQIDEGRHGDTQLDGLKIGMILQWPGAIHEGRGEVVPIVDERASDEQRQA 90  Chelati...
Q92KT9                14 IHCNCAYGCPCQFNA-LPTE--GHCRAIGIVDIDEGHHGDTRLDGLRCGMIVSWPGAIHEGRGAVVPIIDERASDEQREA 90  Sinorhi...
BAK77824              14 ATCNCNWGCPCQFSS-PPTQ--GKCEAVVSMRIDQGQFGEVNLDGLCWVGVFAWPGAIHQGNGSCQIYIEDKASPAQREA 90  Pseudog...
Q12CG4                14 KNCNCAFGCPCDFNA-PPTK--GYCEGLLGMRITKGNFEDTRLDGLSFFVTVRFPGALHEGNGQAQPIIEERATPAQREA 90  Polarom...
WP_013333672          14 KNCNCAFGCPCDFLA-PPTE--GECLGFLGMHIASGHFGDTRLDGLSFFVVVKFPGPLHEGNGDAQPLIDESASPEQLEA 90  Halomon...
jgi:Tter_1985         17 lACNCDYGCPCNFNA-PPTQ--GHCEGGWSWHIDEGSYGDVRLDNLTFSILCDWPGAIHEGNGKALVLIDEHADDAQHEA 93  Thermob...
Q481Y0                15 ENCSCSHGCGCQFGG-FPTSkdGGCEAILGFEILKGHFNDLDLSGLKMVFAAAWPSAMHEGNGKGALFIDNSANEEQVGA 93  Colwell...
goetting:Ngar_c34140  92 LATVLYGGETNKgathWWVYRMMSSTVHPPLFKHIEFDVDIErrKARIVIPDVLESTARPIRSPATGaEHRVRInlpng- 170 Candida...
Q930H8               142 LFTILGGKEQEPtt-vFNIYGSTIAQELEPIFAPIEFHSDIEkrTGGFRIDGHLELELEPIRNPVTGaPHRARIvlpeg- 219 Sinorhi...
WP_013831835          89 LLTIMTGGDTDPfatvFAVFASTIETMHPPGFVPIEFDVDVDgrTGRLRIEGHVEMDGEPIRSPVNGaEVRARInlpdg- 167 Novosph...
Q11KF5                91 LLRIMTGEDTEPgatfFQVFSTTFEKVHDPVFADIEFEIDVDtrTARVNVPGLVEARGEPILNPVTGdEHRARInlprg- 169 Chelati...
Q92KT9                91 LLRIMSGQDTEPgatfFQVFATTFETFHDPVFAPIDFEIDVErrSARVNIPGWMEARGEPIVNPVTGeEHHARInlphg- 169 Sinorhi...
BAK77824              91 LLTILSGQHSDPganvFQIFSTTLSQLYEPQFVPISFAVDPDnrLATTSIAGVLEASGEPIHNPVTGmAQRARLtlpdg- 169 Pseudog...
Q12CG4                91 LFSIMSGKNSAEgt-lFNIFSLIVTKMHDPIFAPVSFEFDKKarTARLSIPGVLETDVEPIKNPVTGaPHRIQVvmpeg- 168 Polarom...
WP_013333672          91 LSEILSGAHSNEgt-lFHIFSLIVARLHDPIIASIEFEFDMAgrTARIEIPGALSSRVTPIRNPVTEePHRIRVvmpeg- 168 Halomon...
jgi:Tter_1985         94 ISTLVSGEVGGP----WAILRHTWTEVYGPY--PAAYELDLRehHSSIRAGSILDLELEPIRNPVTGaEAHPRIllpeg- 166 Thermob...
Q481Y0                94 LATIMSGQAGGMp---VEVLGTLFSEFDGPIMADIKL--NRQdyTSTVTIEGIIEVEQEPHINPVTGeINEVHIsfpkgg 168 Colwell...
goetting:Ngar_c34140 171 iefdlAEIGSG--TTKTMASIALDLKD 195 Candidatus Nitrososphaera gargensis Ga9.2
Q930H8               220 fefrqAEIASG--TFNANGEIAMGRQK 244 Sinorhizobium meliloti
WP_013831835         168 feyeiAEIGSG--SSKSFAPMKLEHSH 192 Novosphingobium sp. PP1Y
Q11KF5               170 feydvCEAGRG--WAETKGPIALSLGD 194 Chelativorans sp. BNC1
Q92KT9               170 feydrCEVGRG--WAETSGPLAVSLAD 194 Sinorhizobium meliloti
BAK77824             170 fefteAEMGSG--HFATHGALAiaspk 194 Pseudogulbenkiania sp. NH8B
Q12CG4               169 fehieGEIASA--NIHSTGAIPFDTTG 193 Polaromonas sp. JS666
WP_013333672         169 fehleGEVASA--DIDSTGDLAFTTRG 193 Halomonas elongata
jgi:Tter_1985        167 fvwkdGCVTASr-KFRVQHSVSYDHSG 192 Thermobaculum terrenum ATCC BAA-798
Q481Y0               169 fmwndGFAGKTklMKINHGNMAFSYSD 195 Colwellia psychrerythraea 34H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap