Conserved Protein Domain Family
DUF1324

?
pfam07038: DUF1324 
Protein of unknown function (DUF1324)
This family consists of several Circovirus proteins of around 60 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 70500
View PSSM: pfam07038
Aligned: 2 rows
Threshold Bit Score: 85.5676
Threshold Setting Gi: 81924308
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O92287  1 MKCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCFATVTRIPLSNKVLTAVDRSLRCP 59  Porcine circovirus
O56125  1 MTCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCSATVTRLPLSNKVLTAVDRSLRCP 59  Porcine circovirus 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap