Conserved Protein Domain Family
DUF1323

?
pfam07037: DUF1323 
Putative transcription regulator (DUF1323)
This family consists of several hypothetical Enterobacterial proteins of around 120 residues in length. This family appears to have an HTH domain and is therefore likely to act as a transcriptional regulator.
Statistics
?
PSSM-Id: 399786
View PSSM: pfam07037
Aligned: 6 rows
Threshold Bit Score: 185.064
Threshold Setting Gi: 82592539
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002913435      8 MTPAELADCLGLARQTINRWVREKQWRTEAIPGVKGGRARLVVIDQPVREFLTNIParrhlltdnHlAESPGAY-LVNEA 86  Enterobacter...
P0AD37            1 MTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNAE---------R-PEGQGEApALSGD 70  Escherichia ...
Q7CQ28            6 MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAE---------RsVDHHADTfTPASN 76  Salmonella e...
wugsc:KPN_02748   1 MTPEEIAHLTGYSRQTINKWVRKEGWQTSPRPGVQGGKARLVHVNEQVREFIRSAQ---------RvAETPGIY--SPHD 69  Klebsiella p...
wugsc:CKO_00397   8 MTTEELAECLGVARQTVNRWIREQGWETEKFPGVKGGRARLIHIDARVQEFILNIPafrnhsafyQaEEPLAEY-SHVVR 86  Citrobacter ...
P27238            8 MTTEELAECLGVAKQTVNRWIREKGWKTEKFPGVKGGRARLILVDTQVCEFIQNTPafhntpmlmEaEERIAEY-APGAR 86  Escherichia ...
WP_002913435     87 DAIWRQITETLQLMTPAEQLQLRDLLAREGISGFLARLGIASP 129 Enterobacteriaceae
P0AD37           71 APLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDS 113 Escherichia coli K-12
Q7CQ28           77 ASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDS 119 Salmonella enterica subsp. enterica serovar Typhi...
wugsc:KPN_02748  70 SDLESLLLTLSKELTPSEQKQLMSLLLREGITGLLLRLGIRDR 112 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
wugsc:CKO_00397  87 SHAYRQIIDAVENMSSKEQEKLAQFLSREGIRGFLARLGLDES 129 Citrobacter koseri ATCC BAA-895
P27238           87 APAYRQIINAIDNMTDIEQEKVAQFLSREGIRNFLARLDIDES 129 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap