Conserved Protein Domain Family
Mic1

?
pfam07035: Mic1 
Colon cancer-associated protein Mic1-like
This family represents the C-terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1.
Statistics
?
PSSM-Id: 399785
View PSSM: pfam07035
Aligned: 22 rows
Threshold Bit Score: 177.044
Threshold Setting Gi: 186509995
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001748829  515 SRRFLIRAVTEYIRSLS-LAEVPVEHLIYEMLINMLVSGKQFYQLHQFFQYHVFDDSEPMACFLLSL-QM-QYPPAYQLA 591  Monosiga brev...
OWR41468      455 sHTLLVQVVTAYLSSLS-RYELVVQHAVCELVVRSLVRAGEGGRLRALVRRGALQDGRPLACQLLSL-GH-LDPAAAQVA 531  Danaus plexip...
ETN59849      476 dtpQLGKILLLYLNSLA-RHGISTNHELSKALLIDLVEHRQFDTLQLLLKHSALNESKALACFLLSL-SNaAYPIVSQMA 553  Anopheles dar...
XP_001841968  464 DSEQLGKILLLYLHSLA-KHGITANHELSKQIVIDLVKNKQFDTLQQLLKYSALNESKPLACFLLSL-SN-SHPSISQMA 540  southern hous...
1_pfamImport    1 EKPFTEDILMVYLQSLS-KYKIPAEDEISKMIIKELIRNENYKTLLLLVEFSLICETKSMACFLLSY-SK-LSPIINQTA 77  
Q9VRX1        461 RRPYTESILMLYLQSLN-KFNIAAQEELSKMIISELISNRSFDTLRRLVSYSMLLESKSVACFLLSH-SN-VDTAISQVA 537  fruit fly
Q95Y58        445 PESYVANIMLQYLRSLF-DAEITPEAYLIEMVVETLAEAGEMSKLQQIVTYRVINDSKPLAFLLLSY-EA-RCSTLFQSG 521  Caenorhabditi...
EMS47948      621 DPAYLIAVIMEFLRSLS-KAGLKAPPDLYVMMTALLACSNRYAEIALFVSNKILEPSRELAMQLIDL-GR-HHSLTRKLG 697  Triticum urartu
Q54LC7        739 DSKYLIAVVIQYIKSLSfNHCTGISDKLYNLLISLLIDNNMFSRLHQFLQYYVITDSLSIAYKLLSI-GE-QYPPVLQLS 816  Dictyostelium...
XP_001032009  859 NKSYLTDILSEYIKQST-ELEIPVESKFQNLLAKLLIEQQKFNTFLFFVQYRIITDNEDLAQILISMnSNtVFKQGFQLG 937  Tetrahymena t...
XP_001748829  592 MDMFKRIeSDPVKICDILLTCGFVLPALRYIKSFGrdIVGRVPAK---------RFLEAALASNDDMLFYNVYNFFIMRN 662  Monosiga brev...
OWR41468      532 LDMMWRL-RAYGEIVEVLLSREEPVSAAGAARQAG--AWGSLAAR---------KLLSAAQQHSRPETFLAIYHALRTRN 599  Danaus plexip...
ETN59849      554 LDMLSRL-NANEIILEVLLERGQIIDALRLAKQMP--GAESLPAR---------KYLEAAYRTNDSLIFHSVFNFFQMKN 621  Anopheles dar...
XP_001841968  541 LDMLARL-NANEIILEVLLEKGQVIEALRIAKQMP--GADSLPAR---------KYLEAASKTQDALVFHSVYAFFQAKN 608  southern hous...
1_pfamImport   78 LDMLRKI-SANEIILEVLLEHGQVIDALRIAKSLP--NSDSISAR---------KYLEAAQKSGDANIFYNVFKYFQQRN 145 
Q9VRX1        538 IDMLGRI-EAHEIIIEVMLGQGKVIDALRLAKNSM--GLEKVPAR---------KFLEAAHKTKDDLIFHSVYRFFQMRN 605  fruit fly
Q95Y58        522 VDILARN-KASDEIVEVMLEKKQIVDAFRFIDVRN--LNDALIP----------KVVEAANQHCVRQTRYAIKEHLTEKK 588  Caenorhabditi...
EMS47948      698 VDMLRER-CLHHDYVAALLQDGYYLEALRYARKYK---VITVQPS---------LFLEEAVAKNITPNLAAVLSFFAEL- 763  Triticum urartu
Q54LC7        817 LDMFKRL-SMPNIIIETLLERGQVIQAIRLLRSTK--ETNEQAYQelltptypiQFLASSSNQSNDTLFFSVFKFFETNN 893  Dictyostelium...
XP_001032009  938 LDMLYRL-KKYYIIINILLRRGLFQQALDFMRKNT---VNKINLK---------EMIKILLSQNGDMKIQSIIEYFREII 1004 Tetrahymena t...
XP_001748829  663 VTLRNKSAFLPD 674  Monosiga brevicollis MX1
OWR41468      600 ERLRGTPDFLTE 611  Danaus plexippus plexippus
ETN59849      622 VRLRGSPDFLKH 633  Anopheles darlingi
XP_001841968  609 IRLRGSPDFLKH 620  southern house mosquito
1_pfamImport  146 LKQRGKVDF--- 154 
Q9VRX1        606 LKLYETLSFPKG 617  fruit fly
Q95Y58        589 AKASLYKSIGDE 600  Caenorhabditis elegans
EMS47948      764 -----TPSFKtt 770  Triticum urartu
Q54LC7        894 LIIPSHPSFDKy 905  Dictyostelium discoideum
XP_001032009 1005 SKSRGNEKFGft 1016 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap