Conserved Protein Domain Family
DUF1319

?
pfam07028: DUF1319 
Protein of unknown function (DUF1319)
This family contains a number of viral proteins of unknown function approximately 200 residues long. Family members seem to be restricted to badnaviruses.
Statistics
?
PSSM-Id: 369174
View PSSM: pfam07028
Aligned: 3 rows
Threshold Bit Score: 136.957
Threshold Setting Gi: 141110
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19200        50 EVIVFTPEVKINLRDLAHNIHIIAHRVALGFKViylylvdiifpllkniqksqkesseNLQSvLKIVKEQRRSLkqiEDQ 129 Commelina yello...
2_pfamImport   1 DYLDLAETHSPTRNELAHNLAVIYDRTCLFSRV-------------------------NLKN-FKAIIEKNQSL---ERE 51 
THU62842     256 DYLNLAETTKPTRKELAHNISVIYDRTCLSSRV-------------------------NLRN-FKLLLEENHNL---QQR 306 Balbis banana
P19200       130 LSKVQSELAKLREDYLSRRPLSKQDVEELVVRISEQPKFIEKQTEALTEELKLKVEEV 187 Commelina yellow mottle virus
2_pfamImport  52 IKGLKHSIKTLTALLSENRPLTKQEVRDLVAEISKQPKLVEEEALRLTQSLNQKLQRV 109
THU62842     307 IKKLKSSVKTLSSLFIENKPLTQSEVQKLVLEISKQPKFIEEEALWLSQNLDQKLQRI 364 Balbis banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap