Conserved Protein Domain Family
DUF1313

?
pfam07011: DUF1313 
Protein of unknown function (DUF1313)
This family consists of several hypothetical plant proteins of around 100 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399774
View PSSM: pfam07011
Aligned: 24 rows
Threshold Bit Score: 105.813
Threshold Setting Gi: 548851528
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002325630  61 QVHSKILQTFQKSFVQVEDILDQNRLLINEINQNQESKIPDKLTRDVGLIKELNINIRRAVGLYADLSCNFNiRSMEPSS 140 black cottonwood
XP_002533647  44 AGDPQVWSTFNTTFRQVQSVLDRNRSLIQQVNENHQSRIPDNMVKNVALIQELNGNISKVVSLYSDLNSNFS-SSYHQHR 122 castor bean
O04211        20 GEDPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVNMYSDLNTSFS-SGFHGGK 98  thale cress
XP_002311221  34 EVDAEVWATFNNSFRQVQSVLDRNRVLIQQVNENHQSRTPDNMVKNVSLIQELNGNISKVVGLYSDLNSNFS-TAYHQRN 112 black cottonwood
Q5GA60        33 EGNSDVWNNFSNRFRQVQSVLDRNRSLIQQVNENHQSRTTDNMVRNVSLIQELNGNISKVVSLYSDISTNFS-TMFRQGN 111 tomato
XP_002270733  46 EGSAEVWETFNDSFRQVQSVLDRNRVLIQQVNENHQSKIPDNLVKNVALIQEINGNISKVVSLYSDLSTNFS-GVFHQPH 124 wine grape
XP_006350838  37 GYDTEAWETITKCFREVQSVLDQNRALIQQVNENHQSKLRDNLVKNVALIRDINSNISKVSRLYSDLSVDFC-NIVHRRR 115 potato
XP_010650900  25 GCDAEVWETLSRSFDQVQSVLDQNRLLIQQVNENQQSRIHDNLVKNVSLTREINGNICKVISMYSKLSADFV-DIVRRRR 103 wine grape
XP_002525644  38 ECDVEVWDTLSRSFRQVQAVLDQNRDLINQVNENHQSKVPDNLTKNISLIREINGNISKVISIYSDLSLRFS-NIVHQRR 116 castor bean
O80877        32 VEDVEVWDTLSNGFKRAQLYLDQNRDLIQRVNENHMSRIPDNVSRNVGLINEINGNISQVMEIYSDLSLNFA-KKFDQRR 110 thale cress
XP_002325630 141 E--GES 144 black cottonwood
XP_002533647 123 N--GNG 126 castor bean
O04211        99 N--GHD 102 thale cress
XP_002311221 113 H--NGK 116 black cottonwood
Q5GA60       112 DfiGDD 117 tomato
XP_002270733 125 E--NEN 128 wine grape
XP_006350838 116 Elalfe 121 potato
XP_010650900 104 A--END 107 wine grape
XP_002525644 117 Rtki-- 120 castor bean
O80877       111 R--TTK 114 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap