Conserved Protein Domain Family
Endomucin

?
pfam07010: Endomucin 
Endomucin
This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.
Statistics
?
PSSM-Id: 399773
View PSSM: pfam07010
Aligned: 10 rows
Threshold Bit Score: 172.749
Threshold Setting Gi: 524994258
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008265788   1 MALLQGTVLVLLLS-SLGGGQDN--------TDVINIATPRVSSSNSTTQ-----TSVSTPNTtl-aPNLEKSTRGTS-- 63  rabbit
XP_007495945   1 MKLLQGTVLFLSLC-SLCYSQESqvsekplmTTVQSTIIVPKSPSPSSEK-----ILESVPTAmitqGKLKTTEATTS-- 72  gray short-tail...
XP_001514360   1 MKLLQVTFLSLSFF-SLSHLDEQ-------------PSNITTSVAPSWTKqetdaTPASTPSA--------SDTVLTT-- 56  platypus
XP_005044948   1 mKLLGTAFFFLAVLcACTVGEDD----------------IQISTVNSTTP-------AVTPKA-------------VE-- 42  Collared flycat...
Q6AY82         1 MRLLQVTALFFLLSnSLCRGENS----------------KALTETSTTKA------SATTPDMv---SITNKSTGGTP-- 53  Norway rat
Q9R0H2         1 MRLLQATVLFFLLSnSLCHSEDG--------KDVQNDSIPTPAETSTTKA------SVTIPGIvs-vTNPNKPADGTP-- 63  house mouse
XP_004748229   1 MKLIQVTILCLLLP-SLCSSNNN--------TDVGSIVPQGLPSATTPSA------TASVPTT----TTMNTVMGSTSem 61  domestic ferret
XP_852385      1 MKFLQVTILCLLLP-SLCSGKKD--------TDVNNTATLVLSTTTFSAAqtftaQTTPTPKS----NPVTELIGGTS-- 65  dog
DAA28848       1 MKLLQGTIFCLLLS-SISSNDQI--------AD----------TSATTTPlsttsEINPTPPT---------RDTRTS-- 50  cattle
Q9ULC0         1 MELLQVTIL-FLLP-SICSSNS---------TGVLEAANNSLVVTTTKPS-------ITTPNTeslqKNVVTPTTGTT-- 60  human
XP_008265788  64 PQGTTN------------SESAKTTLMSTAPSLTT---VKSEGTTSNGVPKNESVTA----------NDTVTNLPPISAV 118 rabbit
XP_007495945  73 PKTSSSliyststnteilKELSSTPMIATSSSPSSavaKTARGTPQNDTSSDVSSTA----------SPQVSTHQLQTTV 142 gray short-tail...
XP_001514360  57 PVTSSE-----------------TAVASTTISPTT-----GRKVATTAADSVTTSSS----------KPVTTAFNISDFT 104 platypus
XP_005044948  43 PVTTTA------------SQTTLAAAVLTTIAVGTt--NETVTTSSTSSSPNATSQTpqgttkqppaATTVASTSLSTAN 108 Collared flycat...
Q6AY82        54 PKGTTN------------SATPKTPLMPALDSPTTp--KHE--TTTRGVIKNEVSTI----------KTTVANPTISNAV 107 Norway rat
Q9R0H2        64 PEGTTK------------SDVSQTSLVTTINSLTTp--KHEVGTTTEGPLRNESSTM----------KITVPNTPTSNAN 119 house mouse
XP_004748229  62 SIGATR------------EKLSSTSLQPTHSSLTTt--LISGGATTSVITKIEVTVT----------NATVTEIPLSNVS 117 domestic ferret
XP_852385     66 STGIIS------------KKSLNASLGPTHPSLLTt--VKSEGTTTSDVMKTDFTGT----------DVTVTKIPLLSAT 121 dog
DAA28848      51 PNGTSS------------KEAAQMPHLLTPSPVTPn--TKGDGASTESIMETKLSTT----------EATVMSQSLSNAV 106 cattle
Q9ULC0        61 PKGTIT------------NELLKMSLMSTATFLTSk--DEGLKATTTDVRKNDSIIS----------NVTVTSVTLPNAV 116 human
XP_008265788 119 STLKSSQhktenQSSSKTTEiivstvntsqPDGPFSETNTLpsaaVTTPAIILQSQg--TEDGKNMSSSS--TNPSYSSV 194 rabbit
XP_007495945 143 STKQSSQ-----QNNIILKS----------PTEKPDETLKF----ITTPPIKDQGS---TRDSGTTSSLL--INSSYSSV 198 gray short-tail...
XP_001514360 105 SSMDNAKvkstpSSSPQENAfst-----------vnaSAHLsriqASTPSATRANTkprVESSTVKSTSSplASPAYSGV 173 platypus
XP_005044948 109 TTQASGTqsaqnESSDAAPTtgqsfsstasPERSTSASVTsd-lpMSSPTNSTKPT---SESPESSSGNQrgSDISYSNI 184 Collared flycat...
Q6AY82       108 STLSSPQnktenQSSIRTTEisgt--nqlpDDQKPKTTETps-asLTTAKTISQIQd--TEDGKITATTS--TTPSYSSV 180 Norway rat
Q9R0H2       120 STLPGSQnktenQSSIRTTEisvt---tqllDALPKITATss-asLTTAHTMSLLQd--TEDRKIATTPS--TTPSYSSI 191 house mouse
XP_004748229 118 STLQSSQhktenQSSIKTAGtpge--sslpPEGSTSHTSTSpsvsVTMPGNNSQFQg--TEDAKNASSSS--ANPSYSSI 191 domestic ferret
XP_852385    122 LTLQSPQhktenQSLIKSKEtpas---tlqPDASPSHTSTLlsisVTIPGNISQFQg--TEDAKNASSSS--ASPSYSSV 194 dog
DAA28848     107 STSQSSDsktetQSSIKATEtpvn---tspPEASSFRTATLssisVTSAENISPSQv-gLENAKNASAST--TSPSYSSI 180 cattle
Q9ULC0       117 STLQSSKpktetQSSIKTTEipgs---vlqPDASPSKTGTLtsipVTIPENTSQSQvigTEGGKNASTSA--TSRSYSSI 191 human
XP_008265788 195 ILPVVIALIVVTLSVFVLVGLYRMCWKTDPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKAKN 264 rabbit
XP_007495945 199 ILPVVIALIAITLSIFILVGLYRMCWKTDPGTPDNGTDQPQSDKESVKLLTVKTISPETSEQSAQGKNKN 268 gray short-tailed opossum
XP_001514360 174 ILPVVITLIVITLLVFILVGLYRMYRKKDPGSPDNGTDQPQSDKESVKLLTVKTLSPETGEQSAQGKNKN 243 platypus
XP_005044948 185 ILPIVITLIVITLSVFSLVALYKMCQKKTPERQENGAEQAQSDKEGVKLLSVKTTSPETGEQSSHGKNKt 254 Collared flycatcher
Q6AY82       181 ILPVVIALIVITVLVFTLVGLYRICWKRDPGTPESGNDQPQSDKESVKLLTVKTISHESGEHSAQGKAKN 250 Norway rat
Q9R0H2       192 ILPVVIALVVITLLVFTLVGLYRICWKRDPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN 261 house mouse
XP_004748229 192 ILPVVIALIVVTLSAFVLVGLYRMCWKTDPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKSKN 261 domestic ferret
XP_852385    195 ILPVVIALIVVTLSAFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKSKN 264 dog
DAA28848     181 ILPIVIALIVITLSVFVLVGLYRMCWKTDPGTQENGNEQPQSDKESVKLLTVKTISHESGEHSAQGKTKN 250 cattle
Q9ULC0       192 ILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN 261 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap