
Conserved Protein Domain Family

pfam06991: MFAP1 
Click on image for an interactive view with Cn3D
Microfibril-associated/Pre-mRNA processing
MFAP1 was first named for proteins associated with microfibrils which are an important component of the extracellular matrix (ECM) of many tissues. For example, MFAP1 has been shown to be associated with elastin-like fibers at the base of Schlemm's canal endothelium cells, in the juxtacanalicular tissue, and in the uveal region. Based on its role in the ECM and the proximity of the MFAP1 gene to FBN1 it was hypothesized that mutations in MFAP1 contributed to heritable diseases affecting microfibrils, Marfan syndrome but this has now been shown not to be the case. MFAP1 has also been shown to interact directly with certain pre-mRNA processing factor proteins, Prps, which are also spliceosome components and is thus required for pre-mRNA processing. MAFP1 bound to Pr38 of yeast is necessary for cells in vivo to progress from G2 to M phase.
PSSM-Id: 399759
Aligned: 105 rows
Threshold Bit Score: 118.425
Threshold Setting Gi: 685408195
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
XP_002291591  352 A---------TVSKPLFVPKSKRGTVAEv-EAQQQKMEEAEERKAKEAERRAFQSRALVAEAVSASGKnas-------as 414  Thalassiosira...
XP_002291591  415 SglGNEDEfdvgeagsefiPIPDDSDP-NEQdspelvlAERDAWEVRELIRILRDVDEAAEAEKEKKELARRRAMTDE-- 491  Thalassiosira...
XP_002180440  348 T--GAQN------------TMPDDADDsDDE-------VARDAWEIREVARLIDELDVEDARLQEERDLSRRRKMTDE-- 404  Phaeodactylum...
EFC48236      289 K--IDEDI-----------LSVNDSDDiDPN-------GEMMAWIEREMKRLSLIKQ---TRDESDKELQRRANNSSF-- 343  Naegleria gru...
EFA80541      276 N--KDDDD-----------DDDDDADE--DG-------SRYDAWVQREINRLKKDIRDKLVLEREQSEKLRRSKMTDK-- 331  Heterostelium...
Q54SU3        274 E--LEQKEe---------eEYDDDEDQ--DG-------SKKLLWIQRELERVRLEIHTRLLAEFEKKEFARRRAMTDD-- 331  Dictyostelium...
GAC75553      232 E--THA-------------TDVDDTDGlDPE-------AEFEAWRQRELARLQRDREALDEKRKAQAELDAFRALPESek 289  Moesziomyces ...
CBQ69921      233 D--SHP-------------TDVDDTDGlDPD-------AEFDAWRQRELARLQRDRDALLAQRAEQAELERFRALPEAek 290  Sporisorium r...
CCF50310      222 S--TQS-------------TEVDDTDGlDPE-------AEFAAWRERELARLRRDQDALLAKQAEQREIEEFKSLPESek 279  Ustilago hordei
EST08318      216 D--TLR-------------TDVDDTDGlDPS-------AEFEAWRQRELSRLHRDRDALLTLQAEQAEIEAFKSLPEAek 273  Kalmanozyma b...
XP_002291591  492 ERLDEDR-RMGRYRApgearrrpKDDKSREN--NYLQRYHHRGAFYMdedtlgqagEddvrHRAAEYSR------AATGE 562  Thalassiosira...
XP_002180440  405 ERLAEDI-ATGRYQRp-------GQPKQTDLdqTSAKRYYHRGAYYMdes---ewdSsdvrHKSAVYAR------AATGD 467  Phaeodactylum...
EFC48236      344 KDSADKEgKSNSQNT-----------EKPKF--KTGQRYYHKGAFFM---------D-----DEEIAEKaaqVAHAPTGK 396  Naegleria gru...
EFA80541      332 EIEAEDAeKLAKRDQ-----------PKQKL--KFMQRDYHRGAFFQ---------D-----DEYIKNK---DFSGATGE 381  Heterostelium...
Q54SU3        332 QILKEDP-SRSRTNI--------DNSQKKQL--KFLQRDYHRGAFFQ---------D-----DEYIKNK---DFSAPTGE 383  Dictyostelium...
GAC75553      290 ERLGRER-AKQQAAE--------KREQRGNP--AFLQKYYHKGSFFQ---------------DMDILQR---DYTEATSS 340  Moesziomyces ...
CBQ69921      291 ERLGRER-AARQQAE--------KKEHRGNP--AFLQKYYHKGSFFQ---------------DMDILKR---DYTEKTTK 341  Sporisorium r...
CCF50310      280 ERLGRER-AAKLKTE--------KMEQRGER--GFLQKYYHKGSFFQ---------------DMDILKR---DYSEKTEK 330  Ustilago hordei
EST08318      274 ERLGRER-AAQLQAE--------KREQKGNP--AFLQKYYHKGSFFQ---------------DMDILKR---DYTEKTSK 324  Kalmanozyma b...
XP_002291591  563 DKVDKSALPKVMQVKKFGFAGYgTKYKGLAKEDT 596  Thalassiosira pseudonana CCMP1335
XP_002180440  468 DKINRAALPEVMRVKKFGFANQnLKYKGLAAEDT 501  Phaeodactylum tricornutum CCAP 1055/1
EFC48236      397 DHINYDLLPKYYQTKNPGRARQ-PKYTNLKDQDT 429  Naegleria gruberi
EFA80541      382 DKFNRELLPKIMQVKNFGKGGR-TKYTHLADQDT 414  Heterostelium album PN500
Q54SU3        384 DKFNRELLPKVMQVKNFGKAGR-TKYTHLKDQDT 416  Dictyostelium discoideum
GAC75553      341 QV-DVSKLPKMMQVRNFGAKGR-SKWTHLANEDT 372  Moesziomyces antarcticus T-34
CBQ69921      342 DV-DVSKLPKMMQVRNYGVKGR-SKWTHLANEDT 373  Sporisorium reilianum SRZ2
CCF50310      331 EV-DVSKLPKMMQKRGWGEKGR-GKWTHLANEDT 362  Ustilago hordei
EST08318      325 DV-DVSQLPKMMQVRGYGVKGR-SKWTHLANEDT 356  Kalmanozyma brasiliensis GHG001
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap