Conserved Protein Domain Family
TMEM70

?
pfam06979: TMEM70 
Assembly, mitochondrial proton-transport ATP synth complex
TMEM70 is a family of proteins essential for assembly of the mitochondrial proton-transporting ATP synthase complex within the inner mitochondrial membrane.
Statistics
?
PSSM-Id: 399754
View PSSM: pfam06979
Aligned: 31 rows
Threshold Bit Score: 137.74
Threshold Setting Gi: 302802397
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9BUB7       107 VKCFSYSTSLIGLTFLPYIFTQNNAISESvpLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNA 186 human
EFX71854      67 VKTFSLGTSCIGLGMQPVLYEHVTSQETS--LPLVVALYSAVGIFTFVTPFLIHFITKKYVTDIMFDPVREEYTASVYKF 144 common water flea
Q7Q817        27 VKVFSLATSIGGIVAQPILLEQASKVGG---MPMIVAVCGFAGFFTFVTPILLHLVTKRYITDLHYDPSKQQYTATTITF 103 Anopheles gambi...
NP_001280423  70 LKIVSFMTSAVGLCIQPMVIQKAAEVGSS--LAATIGVCTIAGFFTFITPVLIHLVTRKYVTSIEYNKKTDEYNATIISF 147 pea aphid
XP_003426743  88 IKLFSLSTSIIGLAVQPVVYQKALLAGTT--TKFTLPAFALIGLLALATPPLLHIITKRYVLSVEYDATKDMYTATTYNL 165 jewel wasp
EFN72973      74 LKIFSLLTSTGGLLAQPFLYSKAIESGN---TGAVLGIFAFIGFLTITTPLLIHIITKKYVTHLYYDAKEDKYIANTYNL 150 Florida carpent...
EEZ99505      67 VKVFSLSSSIVGIVGQPFLYKAIISTGN---VPIIVAAYSFLGFFTFVTPLLLHLITKKYVTHLLYKPENDSYVAKTVNF 143 red flour beetle
XP_004927307  67 IKIFSLCTSIAGIAIQPMLIREASSIGS---TSLLVAICSVVGFFTFVTPILLHFITKKYVTEIYYNAETSTYKAITINF 143 domestic silkworm
XP_002112055  13 LKIFSLSTCAATIVGTPILAYNGKKSIS---ITAKIMISSALISVSVATTVLLHWFSKRYVLQAYSNPTGTKYMMETYTL 89  Trichoplax adha...
XP_011409908  71 LKIFSMTTAALTVSLSPVLVYFGNPATP---LVARVAMSTIVLMAGVSTTLLLHWFVKSYITRMYYDRGSGQVRAFTFDM 147 Amphimedon quee...
Q9BUB7       187 MLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDK 240 human
EFX71854     145 FPIKRKINFKLEDVTVPDVPGAFTTLCVKNVPLLCIPSDFLYPEHYIKFMGYDK 198 common water flea
Q7Q817       104 FLQREKTAFKIEDVTVPEVGGLFTTFLVKNKAFFVDPQLFPDPTHYIKIMGYDK 157 Anopheles gambiae str. PEST
NP_001280423 148 FLKPKKIQFKPFEVRLPLTQKLTVTFYAKEFPLFVDPHAFDDVMHYQRILGYDK 201 pea aphid
XP_003426743 166 LCIRKKIEFTPEDVTIPTVLGMFTTCAIRGKPVFLDAKSFTDQSHYKRIMGYDK 219 jewel wasp
EFN72973     151 FVQTKELVFTPNDVVVPSVTGMFTSCIIKGIPLFLEQKFFYDSTHYIRIMGYDK 204 Florida carpenter ant
EEZ99505     144 FCITKETEFKIDDVKVPDVPGMFTTLLANGKPLFFDPRLFENPEHYARIMGYDK 197 red flour beetle
XP_004927307 144 FATKRIHEFKVEDVFVPDVPGMFTTMHANGKPLFIEARFFNNPLHYAKIMGYDK 197 domestic silkworm
XP_002112055  90 LARRKKIEFTPNDVKLPTADRMFSNVIIFNKPYLFHPEVIQHKDLLMLITGYn- 142 Trichoplax adhaerens
XP_011409908 148 IGREKESIFHVSETAPPTKATSLSTFQAKDRVYYLHANIFDDIDLLLKLAGPDv 201 Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap