Conserved Protein Domain Family
DUF1296

?
pfam06972: DUF1296 
Protein of unknown function (DUF1296)
This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function. Structural modelling suggests this domain may bind nucleic acids.
Statistics
?
PSSM-Id: 399749
View PSSM: pfam06972
Aligned: 24 rows
Threshold Bit Score: 75.4601
Threshold Setting Gi: 552847007
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002964401       25 PASARKVVQNLKEVVGVgHGEEEIFATLKECNMDPNETAQRLMSQDTFHEVKRKRDKKKE 84   Selaginella moellendorffii
XP_004961192       16 PAGSRKLVQSLKEIVN--RPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE 73   foxtail millet
XP_005851760       17 pvaPKKIIDSIKEATG--AQEEEISAMLAECNYDVNEATSRLID-NPFQQVKSRVEKRKE 73   Chlorella variabilis
JCVI:AT4G18150.1   16 PASSRKVIQDLKEIVE--CSELEIYAMLVECDMNPDEAVNRLLSQDTFHEVKSKREKKKE 73   thale cress
EFH39662          110 PVDFKEVVQNVQEIVK--CSEEETKKMLVECNMDADKAVNRLLSQDSVQQVKSNQDEKKE 167  Arabidopsis lyrata subsp. lyrata
KRH38470           22 PVSSRKMVQSLKEIVSN-FPNHKIYATLKDCNMDPNKAVSRLLSQDPFHEVKSKREKKK- 79   soybean
KRH46046           23 vaAEKEMVQCVKEIVN--CTECEIYAALEECDMDVNRAVEMLLSQDTFHEVKSKRERRRE 80   soybean
EFH60921           11 PASTRKTIQNIKETTAGnYSEDEILAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRKE 70   Arabidopsis lyrata subsp. lyrata
XP_002267265       11 SSSMREVIQNIKEVTGD-HTEEEIYAMLKDCAMDPNETVQKLLMQDPFHEVRRKRDKRKE 69   wine grape
XP_002863403       31 PENSREIVQAMKEIV-N-CSEQEIYDMLVECNMNADEAMNRLLSQDSFQEVKSKRNKKKE 88   Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap