5ZZ6,2DT5


Conserved Protein Domain Family
Put_DNA-bind_N

?
pfam06971: Put_DNA-bind_N 
Click on image for an interactive view with Cn3D
Putative DNA-binding protein N-terminus
This family represents the N-terminus (approximately 50 residues) of a number of putative bacterial DNA-binding proteins.
Statistics
?
PSSM-Id: 399748
Aligned: 205 rows
Threshold Bit Score: 52.0513
Threshold Setting Gi: 524379411
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZZ6_B     4 KIPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLS 52  Thermotoga maritima MSB8
CDF14240   6 KISMSVIRRLPRYYRFISELADSGEQRISSGKLAELMNVTASQIRQDFN 54  Eubacterium sp. CAG:581
CDC01670   6 NISMSVIRRLPRYYRFLSELNEQNIDKISSTKLAEIMNVTASQVRQDLN 54  Eubacterium sp. CAG:202
CDE81874   6 EISATVIKRLPRYYRFIGELIKQGTVRASSAELAKEMSLTASQIRQDLN 54  Ruminococcus sp. CAG:353
CCZ83167   6 pVSDSVVRRLPRYYRYLSELERAGVERTSSQALATQLGSTASQIRQDLN 54  Ruminococcus sp. CAG:254
OLA43897   5 KVSNNVIRRLPRYLRKLDELTDAGVSRISSGELGRQLGLTPSQIRQDFS 53  Firmicutes bacterium CAG:24053_14
CDE47922   4 HVSDAVIRRLPGYYRHLRELESAGVEQISSQELGERMHLTPSQIRQDIN 52  Faecalibacterium sp. CAG:74
CDC79946   6 NISSSVIKRLPRYYRFLGELKAQGIDRISSKELAQKMRTTASQVRQDFN 54  Clostridium sp. CAG:964
OKZ80253   6 NISMSIIKRLPRYYRFLQSLKDNGIVRISSKELADRMGLTASQIRHDFN 54  Clostridium sp. CAG:217_53_7
CDC04360   6 NISMSVIRRLPRYYRFLSELKDNGVVRISSRELSDKMGFTASQIRQDLN 54  Clostridium leptum CAG:27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap