3EEY,3LBY,3MTI


Conserved Protein Domain Family
rRNA_methylase

?
pfam06962: rRNA_methylase 
Click on image for an interactive view with Cn3D
Putative rRNA methylase
This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.
Statistics
?
PSSM-Id: 399740
Aligned: 179 rows
Threshold Bit Score: 115.577
Threshold Setting Gi: 219867658
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EEY_H        52 GFDIQDKAIANTTKKLTDLNLId-rVTLIKDGHQNMDKYID-CPVKAVMFNLGYLPSGDHSISTRPETTIQALSKAMELL 129 Hungateiclostri...
CDA72015      51 AFDIQPAAVESTRELLEKRGFAn--GEVHLESHHRIDEYAEeGTVAAIVFNFGWLPGGDHTINTKRDTSIEAIEKGLRLL 128 Ruminococcus sp...
CDE33247      51 AFDIQADAIASTRELLEQHGCNa-qARLFQTSHANMKQLVS-GPVRCVVFNFGWLPGGDHNICTRTQSSLSAIEQGLELL 128 Ruminococcus sp...
CBK98738     150 GFDIQPEAITSTRARLEKQGLT---AELICDSHANLLQYVRsGTADIVMFNFGWLPGADHSVFSTADSSIPALEAALAAL 226 Faecalibacteriu...
CBL01350     150 AFDVQPEAIRSTRTRLEQANVPadrYSLVCGSHADLLQYVQpGTADAVMFNFGWLPGADHAVFSTAQSSIPALQAALQAV 229 Faecalibacteriu...
CDE79277      51 AFDIQQEAIDSTAKLLEEKGLSs-rAELILGSHTQMDSYAEeGTVSCITFNFGWLPGGDHTVHTMKDTSIEAVKKALRLL 129 Ruminococcus sp...
WP_022133530  56 AFDIQQDAVDSTRALLQEKGYQd-rVEVFLDSHSNMDQYAEeNTVDCITFNFGYLPGGNHNIFTTPATSIPAIEKGLKLL 134 Negativibacillu...
CDC68695      49 AFDIQAEAVAQTKALLEQEGLQ---AEVYLDSHENMARYVRpETVDCVVFNFGRLPGGDPKIFTRAESSLRAIDAGLSLL 125 Oscillibacter s...
CDD09739      47 AFDVQKDAVDSTENLLKSRGQT---ADVHLESHENMTKYADrDSVSCIVFNLGYLPSGDHSVFTHAESTIKAIEGGLGLL 123 Clostridium sp....
WP_014750014  50 AFDIQRDALAATAARLGHENLQa-rATLIHDSHAHMLDYVS-EPVSAIIFNLGYLPGADKSCATQANSTLAAVKSALTLL 127 Advenella kashm...
3EEY_H       130 VTGGIITVVIYYGGDTGFEEKEKVLEFLKGVDQKKFIVQRTDFINQANCPPILVCI 185 Hungateiclostridium thermocellum ATCC 2...
CDA72015     129 KPDGVMSLSIYYGRDTGTEERDAILEYLERLPVNEYTALVSRFVNRPNCPPISVrv 184 Ruminococcus sp. CAG:579
CDE33247     129 EEGGIMSLSIYYGKNNGFEERDAILEYLKQLDIRTYSVLVSQFYNRPNCPPISati 184 Ruminococcus sp. CAG:403
CBK98738     227 RAGGVLSAILYSGRVIGTDEKQSILGWLRALPLEKYTVLVCDFANWADTAPLPCLv 282 Faecalibacterium prausnitzii L2-6
CBL01350     230 RPGGIVSAILYSGAVIGSDEKQAVLRFLRALPLKSFTVLVCDFANWAETAPLPCLI 285 Faecalibacterium prausnitzii SL3/3
CDE79277     130 KQGGLISMILYYGRDTGFEEKEALLEFVKTIDSAEYSVITVDFSNRPNCPPIPIFI 185 Ruminococcus sp. CAG:353
WP_022133530 135 KQGGLMSLCVYYGGDSGFEEKDALMEYFRTIDSKQYTVLITEFANRPNNPPIPVFI 190 Negativibacillus massiliensis
CDC68695     126 RPGGVMAIALYYGGENGYDERDAVLSHLETLDQRRFTVLSCRWANRRGDPPMPVFV 181 Oscillibacter sp. CAG:155
CDD09739     124 KKGGLMCVSVYYGGDSGYEERDALLPYLKTLDSSKYQVLKLDFYNWTNDPPFPVFI 179 Clostridium sp. CAG:349
WP_014750014 128 APGGLLLIAIYWGHPAGADEKEALEPFVAQLSPEQYRVLKYEFINRANPAPYLLAV 183 Advenella kashmirensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap