Conserved Protein Domain Family
RecQ5

?
pfam06959: RecQ5 
RecQ helicase protein-like 5 (RecQ5)
This family represents a conserved region approximately 200 residues long within eukaryotic RecQ helicase protein-like 5 (RecQ5). The RecQ helicases have been implicated in DNA repair and recombination, and RecQ5 may have an important role in DNA metabolism.
Statistics
?
PSSM-Id: 399738
Aligned: 12 rows
Threshold Bit Score: 290.616
Threshold Setting Gi: 344236241
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006912283 624 KSCSAPAEPPEPTEYDIPPASQVYSLKPKRVGAGFPKGSCQFQTATELMEKTLAKGEAPQPVPGGEQEPPGRPCDLQGED 703  black flying fox
O94762       625 KSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQAPQPERGGEHEPPSRPCGLLDED 704  human
XP_003461465 624 eSCSAQVEPPEPNEYDIPPASHMYSFKAKRTGAGFLKGSSPFQTATELMGKSHTQEQAPQPTEGGEPEAPSQLCVLQDED 703  domestic guine...
XP_004748970 623 RSCTEPAQPSEPTEYDILPASLVYSPKPRRVGAGFPRGSCSFQTATELMEKTCAKEQAPQPARGGEQEPPSQPCGLQQED 702  domestic ferret
XP_540436    622 RSCSMHAQPPEPTEYDIRPASQVYSLKPKRVGAGFPRGSCPFQTATELMEKTQAEERAPQPVQEGKREPPSQPCGLQDED 701  dog
NP_001179255 624 sSCSAQAEPPEPTEHDILPASQVYSLKPKRVGAGFPKGSCLFQTATELMEKTWVPEQEPRPKQGGERGAPSQPCDCQGAE 703  cattle
XP_023600488 576 ggaksrSAPAEPTEHDILPASQVYSLKPKRVGAGFPKGSIPFQTASQLMEEMRAGGQAPRPEQKGEQEPPSQPRGLQDEE 655  little brown bat
XP_005332622 626 KSCSGQAEPPEPNEYDIPPASHVYSLKAKRVGAGFPKGSCPFQTATELMEKSRTQESS-QPVQGDEKEPPSQPSGIQDKD 704  thirteen-lined...
EGV92344     114 KSCSAGVEPSEPNDYDVPPTSHIYSLKPKRVGAGFPKGASPFQTATELLG-----KQAPKGVPGGEQGPPSWCCDYQDED 188  Chinese hamster
Q8VID5       626 KSCGAAAEFSEPSDYDIPPTSHVYSLKPKRVGAGFSKGPCSFQTATELLGKSHSQKQAPEAMLEGGQEPPGWVCDLQDED 705  house mouse
XP_008249172 627 KR-SAQAEPSEPSEYDIPPASQVYSLKAKRVGAGFPKGSCLFQTATELMGKTQPQDGAPQPVQREEQEPPSQPCALQDEG 705  rabbit
XP_012658591 320 KSCSAQAEPSEYDEYDIPPTSHVYSLKPKRVGAGFPKGSCTFQTATELMETSQIQEQAPQPMRGDEQETPNQPGGLKDKD 399  small-eared ga...
XP_006912283 704 SSEPNPRLRGEAPRSSAHCGGPSPKKKAKGPSRGSAIAKTRANKKQQLLATAACKDSQSITRFFCQGAESPAPRTSAPGA 783  black flying fox
O94762       705 GSEPLPGPRGEVPGGSAHYGGPSPEKKAKSSSGGSSLAKGRASKKQQLLATAAHKDSQSIARFFCRRVESPALLASAPEA 784  human
XP_003461465 704 RSVLLPGPSEEAPAGRAYCGGPSPEKKLKGSCGNRSVAKAQASKKQQLLATAAHKGSQNITRFFCQRVANPLVLSAALRA 783  domestic guine...
XP_004748970 703 CSEPFPGPGGEAPGSRAHCRGSSPETVKSSSTKGS--AKARASKKQQLLAAAALKDSQNIARF-CQRAKSPSPLTSAPGA 779  domestic ferret
XP_540436    702 CSKALPGPRAEAPGSSFHCGGSSPEKTGKSPSKGGPLAKARASKKQQLLAAAALKDSQNITRF-CLRAKSPSPLTSAPGA 780  dog
NP_001179255 704 PAKSLPGPQGEAPRSGAVCRGPSPEE-ERGPARGSPTAKARVNKKQQLLAAAALKDSQNIARFFCRRTKSPPPVTAAPGA 782  cattle
XP_023600488 656 SSEPVPGLR-EAPGSSAHCGGPSPEK-AKGPSGGSPAAKARANKKQQLLAAAALKDSQNIARFFCQRAESPPALASAPGA 733  little brown bat
XP_005332622 705 VSEGLPGPKGEDPGGSAHCAGPSAEK-VKASSRSSSVTKARASKKQQLLATAAQKDSQNIARFFCQRAENPPPLTTAPRA 783  thirteen-lined...
EGV92344     189 RNKPLPENQREAPGSSVNCGELSPQKRTKGSSQGS--VRAGASKKQQLLAAAALKDSQSITRFLCQRAESLPSPAPGPRS 266  Chinese hamster
Q8VID5       706 RSKPHPGYQEKALGSSVNCGDPSPEKKTKGSSQGS--AKARASKKQQLLATAARKDSQNITRFLCQRTESPPLPASVPRS 783  house mouse
XP_008249172 706 CSEPLPGPRPKASGGGAHCGGPSPEKKAKGSPGSQSVAKTSASKKQQLLAAAARKDSQDITRFFCQRAGSP-----APGA 780  rabbit
XP_012658591 400 RSIPLPGPSKETPGDSAHWEGPSPEKKARGFSGGSSAAKARANKKQQLLATAAHKDSQNITRFFYQRVESPPRLASAPRA 479  small-eared ga...
XP_006912283 784 KGA--SPSCEGVRGPPAvTPEKCTGEEDG--APGHLAACAQTKERTR 826  black flying fox
O94762       785 EGA--CPSCEGVQGPPM-APEKYTGEEDG--AGGHSPAPPQTEECLR 826  human
XP_003461465 784 EGA--SLSCEGVQGPFM-APEKNTEKKDG--AQGHITA-LHTEKFSG 824  domestic guinea pig
XP_004748970 780 EGA--GPSCEGVRGPPA-APEECSGEEDG--ALGCLAVPSQTKECTR 821  domestic ferret
XP_540436    781 EDAgpGPSCEGMRGPPA-APEKCAGEEDG--ALGCLAAHPQTKECTR 824  dog
NP_001179255 783 DGT--SPSRDGARGPLT-FLEKGSGQEDG--AVGHLAARPETKECAE 824  cattle
XP_023600488 734 EGA--SPSCAKVRGPLAvAPETCTGEEDG--ALGRSAACPQT-ECTR 775  little brown bat
XP_005332622 784 DGA--SPSCGRKQEPLM-TSEKCTEEESG--LRGYLMDPPQTEACPS 825  thirteen-lined ground squirrel
EGV92344     267 GDV--TPSCGG-------EPEDCT--QVG--AQAHLSARVQT-ECPR 299  Chinese hamster
Q8VID5       784 EDA--SPSCGD-------VPGKCT-QEVG--AQGHLVAVFQT-EGPR 817  house mouse
XP_008249172 781 EDA--SPACGGVQETP---PEKCAEEEDGarAQGRLPAPLQTEECPG 822  rabbit
XP_012658591 480 KDA--SPSCEGAQGPPM-APEK----EDG--AQRCLNAPPRTEENTI 517  small-eared galago
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap