Conserved Protein Domain Family
DUF1290

?
pfam06947: DUF1290 
Protein of unknown function (DUF1290)
This family consists of several bacterial small basic proteins of around 100 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399729
Aligned: 72 rows
Threshold Bit Score: 62.1144
Threshold Setting Gi: 123338779
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013424085    78 APGWLAPYLPVAVVAALDALAGGLRAALERVFDDLVFVVSFLTNAGVAVALVAVGEQLGVggALTTGVVVVFGIRIFTNA 157 Frankia ineff...
ACI17181        43 fsasQVRYIGVLVLVVLDAIFGGIRAEIQDMFDIVIFTSGIAVGGLMAVWLLFLGDLFGI--DLSLAAVVTFGGRIFQNV 120 Coprothermoba...
WP_013807936    21 IPVYLQPYLPIAVVAALDALFGGLRAYFEGIFDSKVFVVSFIFNVTVASLLVFLGDLLGVgtQLSTAVLVVLGIRIFGNA 100 Hoyosella
CBL56757        21 VPVGLQPYLPIMIVAALDALFGGVLAWLKGTFSDRVFVVSFVSNVAVAALLVWVGDLIGVgsQLSTAVIVVLGIRIFTNV 100 Propionibacte...
WP_003809295    21 IPIELQPYLPIMVLAALDALLGAARAYFQRSFSDKVFVISFFSNVITATLLVFLGNQLGVgsQLQTAVIVVLGIRIFTNV 100 Bifidobacterium
EFT83841        21 VPIWLQPYLPIMVVAALDALLGAARSYFERNFSDRVFIISFIANVVTAALLVLIGSQLGVgsQLTTAVIVVLGIRIFSNV 100 Parascardovia...
jgi:Bcav_2104   21 VPTELQPYLPIAVVAALDALFGGVRARLDGVFDDRVFVTSFLSNVVVAALLVFLGDQLGVgaQLSTAVVVVLGIRIFSNA 100 Beutenbergia ...
jgi:Bfae_15500  21 VPAALQPYLPIAVVAALDTLAGGLRASLDGAFDSHVFITSFLFNVMIAAFLVFLGDQLGVgsQLSTAVIVVLGIRIFSNA 100 Brachybacteri...
WP_016482349    31 VPPQLAPYLSLAALAGLDTVFGGIRAGIEGRFQNDIFTSGFILNTLLAALLAWIGDHLGI--NLAFVAVLVLGARVFNNL 108 Chthonomonas ...
WP_025227989    25 lPGAFGQYLAVACLAGFDTICGGVRSGMEGKFRTDVFITGFLSNILIAFFLAWLGDQIYI--NLFLAVALVLGARIFTNL 102 Fimbriimonas ...
WP_013424085   158 TALRRHLF 165 Frankia inefficax
ACI17181       121 SIIRRILI 128 Coprothermobacter proteolyticus DSM 5265
WP_013807936   101 AAIRRGVF 108 Hoyosella
CBL56757       101 AGIRREVL 108 Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
WP_003809295   101 SSIRRFIF 108 Bifidobacterium
EFT83841       101 SAIRRYIF 108 Parascardovia denticolens DSM 10105 = JCM 12538
jgi:Bcav_2104  101 ASIRRSLL 108 Beutenbergia cavernae DSM 12333
jgi:Bfae_15500 101 AAIRRLLF 108 Brachybacterium faecium DSM 4810
WP_016482349   109 SLIRRYYL 116 Chthonomonas calidirosea
WP_025227989   103 SLIRRFAL 110 Fimbriimonas ginsengisoli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap