Conserved Protein Domain Family
GlpM

?
pfam06942: GlpM 
GlpM protein
This family consists of several bacterial GlpM membrane proteins. GlpM is a hydrophobic protein containing 109 amino acids. It is thought that GlpM may play a role in alginate biosynthesis in Pseudomonas aeruginosa.
Statistics
?
PSSM-Id: 399726
Aligned: 10 rows
Threshold Bit Score: 128.653
Threshold Setting Gi: 1707979
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6AQN8         6 FKCSIGAFAVLTIALLSRSKSFFIAGLVPLFPTFALIAHYIVGSERSPMELRTTALFGLYSIMPYAAYLFAVYYFSIRFN 85  Desulfotalea ps...
Q9KLV8         6 FKCLLGALAVLIIALLSKTKSFFISGLVPLFPTFALIAHYIVGTERTMEDLRTTALFGLYSLIPYAAYLLAVYYFSYRLS 85  Vibrio cholerae
CAV18324       3 FKCLLGAAAVLLIALLSKSKSFYIAGLVPLFPTFALIAHYIVGTEQTMVELRTTALFGLFSLVPYAAYLGAVYVFSYRYN 82  Vibrio tasmanie...
Q7MCE8        24 LKSLLGAAAVVIIALLSKSKNFYIAGLVPLFPTFALIAHFIVGSERSMEDLRQTALFGLWSLLPYAAYLAAVYYFSYRFS 103 Vibrio vulnific...
Q6F760         7 LKCTLGAAVVLLISILSKSKTFYIAGLVPLFPTFALIAHVIVFGQQGAEALRKTALFGLWSLIPYAVYLGMVYYFANRLP 86  Acinetobacter b...
P52112         2 FKALIGAAVVVLLAVLSKTRNYYIAGLVPLFPTFALIAHYIVGKGRSLDDLKTTIVFGMWSIIPYFVYLAALYLLVERFR 81  Pseudomonas aer...
WP_002218408   5 LKVLIGTGMVLMIALLSKTRHYYIAGLIPLFPTFALITHYIVGTERSIDALRITIKFGLWAIIPYFIYLISLYFFIEHMR 84  Yersinia pseudo...
Q6DAZ4        41 IKSVIGALIVLLISVLAKSRNYYIAGLVPLFPTFALIAHYIVGTERGLDALRTTILFGIWSVIPYLAYLISLYYFTGWMK 120 Pectobacterium ...
WP_002903379   5 IKGLLGALVVVLIGVLAKTKNYAIAGLVPLFPTFALIAHYIVASERGIEALRATIVFGMWSILPYFIYLLSLWYFTGIMR 84  Enterobacteriaceae
Q8ZPL2         5 IKAALGALVVVLIGLLSKTKNYYIAGLIPLFPTFALIAHYIVASERGIDAMRTTIAFSMWSIIPYFIYLATLWYFSGVMR 84  Salmonella ente...
Q6AQN8        86 LVTNLLLSTAIWIIFAAVLLVTWVKLH 112 Desulfotalea psychrophila
Q9KLV8        86 LTGTLVCATLVWLVFAALLLVGWTRLH 112 Vibrio cholerae
CAV18324      83 LVSTLSLATIVWVLCASMLLLGWTRLv 109 Vibrio tasmaniensis LGP32
Q7MCE8       104 LVTTLSAATVIWLMAASLLIGAWTKVM 130 Vibrio vulnificus YJ016
Q6F760        87 IGLCLTVATLTWVIVAAGLIYGWNSYF 113 Acinetobacter baylyi
P52112        82 LETSLALAALAWLVAASVLVGLWVRLH 108 Pseudomonas aeruginosa PAO1
WP_002218408  85 LSLALISAVLCWVIAAWILISIWSQWH 111 Yersinia pseudotuberculosis complex
Q6DAZ4       121 LPQALLAAVVCWSVSAALLIKIWTWYQ 147 Pectobacterium atrosepticum
WP_002903379  85 LPLALAGAVGCWGLCAWLLILGWSRFH 111 Enterobacteriaceae
Q8ZPL2        85 LPVALGGAVVCWGLSAWLLIFCWIKWH 111 Salmonella enterica subsp. enterica serovar Typhimurium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap