Conserved Protein Domain Family

pfam06933: SSP160 
Special lobe-specific silk protein SSP160
This family consists of several special lobe-specific silk protein SSP160 sequences which appear to be specific to Chironomus (Midge) species.
PSSM-Id: 115579
Aligned: 2 rows
Threshold Bit Score: 1093.66
Threshold Setting Gi: 74763818
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O44418 719 AACVAGLPTCTYPFISSAGCCPSGKTLNTGLGGRGCCK 756 Chironomus pallidivittatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap