Conserved Protein Domain Family
DUF1283

?
pfam06932: DUF1283 
Protein of unknown function (DUF1283)
This family consists of several hypothetical proteins of around 115 residues in length which seem to be specific to Enterobacteria. The function of the family is unknown.
Statistics
?
PSSM-Id: 399721
View PSSM: pfam06932
Aligned: 16 rows
Threshold Bit Score: 114.817
Threshold Setting Gi: 306528545
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015697317         43 GgtgNDAMTNEEARQSKEQWNETQRLRAMKNQRNEKDFSKYDNSIDLRDKCEASQNINAYWEPNTERCLDRRTGRQL 119 Rahnella aq...
ADD77134             32 G---SSALSNEAARQSKEQWNDTHMLRNKVNSRVEKEFDKADRAFDTRDKCEQSANLNAYWEPNTLRCLDRRTGRPV 105 Pantoea ana...
CAX59524             40 G---NNALSNEQARQEKEQWDETHRLRNKVNSRVEKNFDKYDRAADTRDACDQSLNVNAYWEPNTQRCLDRRSGRQI 113 Erwinia bil...
WP_015871297         44 Gg-qDNSLTKEQAREQREQWDQTRPLRSKVNTHVEKAFDKADRAIEQRERCERSLNVNAYWEPGTRRCLDRQSGHPL 119 Edwardsiell...
WP_024913127         45 G---DGAMSQEQARESKEQWDDTHSLRRKVNTRVEKEFDKADRSIDDEERCNGSYNVNAYWESTTRKCLDRTTGRPI 118 Chania mult...
WP_004239248         43 G---DTALEKERARQEKEQWDDTRSLRQKINRRAEKEFDKVDRAIDAEDACLKSSVVTAYWEPNTLRCLDANTGREV 116 Morganella
A6T8U4               38 G---DSAQSRQQASMEKEQWNDTRSLRQKVNKRAEKEWDKADVAFDAQDNCQKSANVNAYWEPNTLRCLDRRTGRAI 111 Klebsiella ...
A8AGU6               38 G---DSAQSRQHAAMEKEQWNDTRSLRQKVNTRTEKEWDKADAAFDNRDKCEQSANLNAYWEPNTLRCLDRRTGRTV 111 Citrobacter...
goetting:EBL_c22160  37 G---DNARSRQEAAMDKEQWGDTRSLRQKINSRAEKEWDKADNAFDKRDACLQSSNVNAYWEPSTRRCLDRSTGFAI 110 Shimwellia ...
Q2NSY2               36 G---DTARSWEAARQSQEQWNATHGLRNKVNTRVEKDFDRYDQAVDLQEKCNSSQNVNAYWEPNTSRCLDRRTGRSL 109 Sodalis glo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap